StarFunc result for job id O95859

User Input

>input (305 residues)
MAREDSVKCLRCLLYALNLLFWLMSISVLAVSAWMRDYLNNVLTLTAETRVEEAVILTYF
PVVHPVMIAVCCFLIIVGMLGYCGTVKRNLLLLAWYFGSLLVIFCVELACGVWTYEQELM
VPVQWSDMVTLKARMTNYGLPRYRWLTHAWNFFQREFKCCGVVYFTDWLEMTEMDWPPDS
CCVREFPGCSKQAHQEDLSDLYQEGCGKKMYSFLRGTKQLQVLRFLGISIGVTQILAMIL
TITLLWALYYDRREPGTDQMMSLKNDNSQHLSCPSVELLKPSLSRIFEHTSMANSFNTHF
EMEEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95859	1.000	1.000	2.324E-45	305	1.000	1.000	O95859.pdb.gz	TSN12_HUMAN Tetraspanin-12 OS=Homo sapiens OX=9606 GN=TSPAN12 PE=1 SV=1
2	AFDB:A0A024RB05	0.621	0.769	8.052E-13	238	0.226	0.290	A0A024RB05.pdb.gz
3	AFDB:P28648	0.604	0.747	8.923E-13	238	0.226	0.290	P28648.pdb.gz	CD63_RAT CD63 antigen OS=Rattus norvegicus OX=10116 GN=Cd63 PE=1 SV=2
4	AFDB:O75954	0.609	0.749	1.652E-12	239	0.223	0.285	O75954.pdb.gz	TSN9_HUMAN Tetraspanin-9 OS=Homo sapiens OX=9606 GN=TSPAN9 PE=1 SV=1
5	AFDB:O14817	0.600	0.742	2.907E-12	238	0.207	0.265	O14817.pdb.gz	TSN4_HUMAN Tetraspanin-4 OS=Homo sapiens OX=9606 GN=TSPAN4 PE=1 SV=1
6	AFDB:O60637	0.657	0.778	3.249E-11	253	0.200	0.241	O60637.pdb.gz	TSN3_HUMAN Tetraspanin-3 OS=Homo sapiens OX=9606 GN=TSPAN3 PE=2 SV=1
7	AFDB:O43657	0.670	0.820	3.790E-11	245	0.197	0.245	O43657.pdb.gz	TSN6_HUMAN Tetraspanin-6 OS=Homo sapiens OX=9606 GN=TSPAN6 PE=1 SV=1
8	AFDB:B0BNE7	0.606	0.721	4.200E-11	249	0.190	0.233	B0BNE7.pdb.gz	B0BNE7_RAT Tetraspanin OS=Rattus norvegicus OX=10116 GN=Tspan7 PE=3 SV=1
9	AFDB:O35566	0.645	0.766	1.114E-10	253	0.230	0.277	O35566.pdb.gz	CD151_MOUSE CD151 antigen OS=Mus musculus OX=10090 GN=Cd151 PE=1 SV=2
10	AFDB:Q6P2T9	0.615	0.766	1.368E-10	237	0.184	0.236	Q6P2T9.pdb.gz	Q6P2T9_DANRE Tetraspanin OS=Danio rerio OX=7955 GN=cd163 PE=1 SV=1
11	PDB:6wvgA	0.486	0.350	3.178E-7	443	0.184	0.126	6wvgA.pdb.gz
12	PDB:6k4jA	0.449	0.598	3.522E-7	220	0.174	0.241	6k4jA.pdb.gz
13	PDB:5tcxA	0.373	0.510	1.218E-5	208	0.167	0.245	5tcxA.pdb.gz	Crystal Structure of a Full-Length Human Tetraspanin Reveals a Cholesterol-Binding Pocket.
14	PDB:7zw1A	0.431	0.420	1.934E-5	317	0.174	0.167	7zw1A.pdb.gz
15	PDB:7zw1B	0.390	0.380	4.002E-4	316	0.167	0.161	7zw1B.pdb.gz
16	PDB:6r7xA	0.123	0.065	1.089	629	0.138	0.067	6r7xA.pdb.gz	The structural basis of lipid scrambling and inactivation in the endoplasmic reticulum scramblase TMEM16K.
17	PDB:6wvdA	0.277	0.219	1.407	397	0.082	0.063	6wvdA.pdb.gz
18	PDB:7eebB	0.137	0.147	1.915	281	0.105	0.114	7eebB.pdb.gz	Structure of a mammalian sperm cation channel complex.
19	PDB:7n6g3I	0.179	0.145	2.016	401	0.102	0.077	7n6g3I.pdb.gz	Cryo-EM structure of an active central apparatus.
20	PDB:4o9yA	0.166	0.031	2.122	2490	0.098	0.012	4o9yA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95859	0.0	634	305	1.000	1.000	TSN12_HUMAN Tetraspanin-12 OS=Homo sapiens OX=9606 GN=TSPAN12 PE=1 SV=1
2	Q8BKT6	0.0	624	305	0.980	0.980	TSN12_MOUSE Tetraspanin-12 OS=Mus musculus OX=10090 GN=Tspan12 PE=1 SV=1
3	P08962	1.94e-22	95.5	238	0.230	0.294	CD63_HUMAN CD63 antigen OS=Homo sapiens OX=9606 GN=CD63 PE=1 SV=2
4	F8W022	8.89e-22	93.2	215	0.223	0.316	F8W022_HUMAN Tetraspanin (Fragment) OS=Homo sapiens OX=9606 GN=CD63 PE=1 SV=1
5	F8VWK8	9.97e-22	93.2	217	0.223	0.313	F8VWK8_HUMAN Tetraspanin (Fragment) OS=Homo sapiens OX=9606 GN=CD63 PE=1 SV=1
6	P28648	4.60e-20	89.0	238	0.233	0.298	CD63_RAT CD63 antigen OS=Rattus norvegicus OX=10116 GN=Cd63 PE=1 SV=2
7	O75954	7.01e-19	85.9	239	0.213	0.272	TSN9_HUMAN Tetraspanin-9 OS=Homo sapiens OX=9606 GN=TSPAN9 PE=1 SV=1
8	P41731	1.30e-18	85.1	238	0.226	0.290	CD63_MOUSE CD63 antigen OS=Mus musculus OX=10090 GN=Cd63 PE=1 SV=2
9	Q8BJU2	2.19e-18	84.3	239	0.226	0.289	TSN9_MOUSE Tetraspanin-9 OS=Mus musculus OX=10090 GN=Tspan9 PE=1 SV=1
10	P48509	1.78e-16	79.3	253	0.230	0.277	CD151_HUMAN CD151 antigen OS=Homo sapiens OX=9606 GN=CD151 PE=1 SV=3
11	P40241	6.06e-16	77.4	226	0.203	0.274	CD9_RAT CD9 antigen OS=Rattus norvegicus OX=10116 GN=Cd9 PE=1 SV=2
12	P40240	1.24e-15	76.6	226	0.210	0.283	CD9_MOUSE CD9 antigen OS=Mus musculus OX=10090 GN=Cd9 PE=1 SV=2
13	P27701	3.55e-15	76.3	267	0.200	0.228	CD82_HUMAN CD82 antigen OS=Homo sapiens OX=9606 GN=CD82 PE=1 SV=1
14	Q9QZA6	8.81e-14	72.0	253	0.230	0.277	CD151_RAT CD151 antigen OS=Rattus norvegicus OX=10116 GN=Cd151 PE=1 SV=2
15	Q7ZUH9	2.24e-13	70.5	227	0.170	0.229	Q7ZUH9_DANRE Tetraspanin OS=Danio rerio OX=7955 GN=cd9l PE=2 SV=1
16	Q9DCK3	4.64e-13	69.7	238	0.233	0.298	TSN4_MOUSE Tetraspanin-4 OS=Mus musculus OX=10090 GN=Tspan4 PE=1 SV=1
17	O35566	7.41e-13	69.3	253	0.223	0.269	CD151_MOUSE CD151 antigen OS=Mus musculus OX=10090 GN=Cd151 PE=1 SV=2
18	Q9JJW1	9.37e-13	68.6	221	0.177	0.244	TSN2_RAT Tetraspanin-2 OS=Rattus norvegicus OX=10116 GN=Tspan2 PE=1 SV=1
19	Q922J6	1.29e-12	68.2	221	0.177	0.244	TSN2_MOUSE Tetraspanin-2 OS=Mus musculus OX=10090 GN=Tspan2 PE=1 SV=1
20	P41732	1.55e-12	68.2	249	0.187	0.229	TSN7_HUMAN Tetraspanin-7 OS=Homo sapiens OX=9606 GN=TSPAN7 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00335 Tetraspanin	9.4e-34	128.7	Tetraspanin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000014348

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000013870	0.776	ADAM metallopeptidase domain 10
2	61853.ENSNLEP00000002992	0.712	NDP, norrin cystine knot growth factor
3	61853.ENSNLEP00000019589	0.705	Frizzled class receptor 4
4	61853.ENSNLEP00000007969	0.693	Low density lipoprotein receptor-related protein 5
5	61853.ENSNLEP00000015409	0.662	Kinesin family member 11
6	61853.ENSNLEP00000017179	0.639	Zinc finger protein 408
7	61853.ENSNLEP00000014788	0.620	Belongs to the G-protein coupled receptor 2 family.
8	61853.ENSNLEP00000015233	0.588	Tetraspanin 17
9	61853.ENSNLEP00000013891	0.567	Tetraspanin 15
10	61853.ENSNLEP00000015155	0.559	Low density lipoprotein receptor
11	61853.ENSNLEP00000019531	0.559	Fucokinase
12	61853.ENSNLEP00000020184	0.555	Teneurin transmembrane protein 4
13	61853.ENSNLEP00000016997	0.552	Tetraspanin 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.393	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.996	multicellular organismal process
GO:0050789	0.991	regulation of biological process
GO:0048856	0.991	anatomical structure development
GO:0009987	0.988	cellular process
GO:0050794	0.983	regulation of cellular process
GO:0050896	0.944	response to stimulus
GO:0051239	0.927	regulation of multicellular organismal process
GO:0007275	0.910	multicellular organism development
GO:0050793	0.894	regulation of developmental process
GO:0048731	0.872	system development
GO:1901342	0.865	regulation of vasculature development
GO:0009653	0.827	anatomical structure morphogenesis
GO:0051716	0.795	cellular response to stimulus
GO:0007165	0.685	signal transduction
GO:0048513	0.674	animal organ development
GO:0007166	0.671	cell surface receptor signaling pathway
GO:0022603	0.449	regulation of anatomical structure morphogenesis
GO:0060041	0.437	retina development in camera-type eye
GO:0048646	0.402	anatomical structure formation involved in morphogenesis
GO:0048518	0.367	positive regulation of biological process
GO:0009887	0.336	animal organ morphogenesis
GO:0045765	0.321	regulation of angiogenesis
GO:0048522	0.306	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005886	0.991	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]