StarFunc result for job id O95861

User Input

>input (308 residues)
MASSNTVLMRLVASAYSIAQKAGMIVRRVIAEGDLGIVEKTCATDLQTKADRLAQMSICS
SLARKFPKLTIIGEEDLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLD
GTKEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYEAGPDAVLGRTIWGVLGLGAFGF
QLKEVPAGKHIITTTRSHSNKLVTDCVAAMNPDAVLRVGGAGNKIIQLIEGKASAYVFAS
PGCKKWDTCAPEVILHAVGGKLTDIHGNVLQYHKDVKHMNSAGVLATLRNYDYYASRVPE
SIKNALVP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95861	1.000	1.000	4.627E-67	308	1.000	1.000	O95861.pdb.gz	BPNT1_HUMAN 3'(2'),5'-bisphosphate nucleotidase 1 OS=Homo sapiens OX=9606 GN=BPNT1 PE=1 SV=1
2	PDB:2wefA	0.978	0.994	2.441E-61	303	0.984	1.000	2wefA.pdb.gz	Human 3'(2'), 5'-Bisphosphate Nucleotidase 1 (Bpnt1) in Complex with AMP, Po4 and Magnesium
3	AFDB:Q23493	0.920	0.889	3.499E-34	319	0.438	0.423	Q23493.pdb.gz	Q23493_CAEEL 3'(2'),5'-bisphosphate nucleotidase 1 OS=Caenorhabditis elegans OX=6239 GN=bpnt-1 PE=1 SV=1
4	AFDB:Q9VYF2	0.789	0.689	3.660E-23	355	0.286	0.248	Q9VYF2.pdb.gz	IMPA3_DROME Putative inositol monophosphatase 3 OS=Drosophila melanogaster OX=7227 GN=CG15743 PE=2 SV=1
5	AFDB:A0A024R7W0	0.804	0.695	1.204E-20	359	0.286	0.245	A0A024R7W0.pdb.gz
6	AFDB:O76455	0.763	0.639	4.732E-18	375	0.260	0.213	O76455.pdb.gz	O76455_DROME Inositol polyphosphate 1-phosphatase OS=Drosophila melanogaster OX=7227 GN=Ipp PE=2 SV=1
7	AFDB:P20456	0.666	0.735	5.021E-18	277	0.208	0.231	P20456.pdb.gz	IMPA1_BOVIN Inositol monophosphatase 1 OS=Bos taurus OX=9913 GN=IMPA1 PE=1 SV=1
8	PDB:2bjiA	0.648	0.723	6.660E-18	274	0.208	0.234	2bjiA.pdb.gz	High-resolution structure of myo-inositol monophosphatase, the putative target of lithium therapy.
9	PDB:6giuA	0.676	0.751	7.953E-18	275	0.211	0.236	6giuA.pdb.gz	Co-crystallization of human inositol monophosphatase with the lithium mimetic L-690,330.
10	PDB:4as5A	0.649	0.723	1.437E-17	274	0.208	0.234	4as5A.pdb.gz	Cloning, Expression, Purification, Crystallization and X-Ray Analysis of Inositol Monophosphatase from Mus Musculus and Homo Sapiens.
11	AFDB:Q91UZ5	0.672	0.711	2.202E-17	290	0.231	0.245	Q91UZ5.pdb.gz	IMPA2_MOUSE Inositol monophosphatase 2 OS=Mus musculus OX=10090 GN=Impa2 PE=1 SV=1
12	AFDB:P29218	0.668	0.737	2.960E-17	277	0.218	0.242	P29218.pdb.gz	IMPA1_HUMAN Inositol monophosphatase 1 OS=Homo sapiens OX=9606 GN=IMPA1 PE=1 SV=1
13	AFDB:P21327	0.654	0.517	7.627E-17	400	0.286	0.220	P21327.pdb.gz	INPP_BOVIN Inositol polyphosphate 1-phosphatase OS=Bos taurus OX=9913 GN=INPP1 PE=1 SV=2
14	AFDB:Q57YS3	0.708	0.576	7.627E-17	390	0.247	0.195	Q57YS3.pdb.gz	Q57YS3_TRYB2 Inositol polyphosphate 1-phosphatase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.10K10.600 PE=3 SV=1
15	PDB:6ib8B	0.637	0.720	1.939E-16	270	0.175	0.200	6ib8B.pdb.gz	Structural basis for the function of SuhB as a transcription factor in ribosomal RNA synthesis.
16	PDB:6wroA	0.661	0.625	2.057E-16	327	0.273	0.257	6wroA.pdb.gz
17	PDB:1inpA	0.666	0.525	2.934E-16	400	0.299	0.230	1inpA.pdb.gz	Crystal structure of inositol polyphosphate 1-phosphatase at 2.3-A resolution.
18	PDB:1k9yA	0.736	0.649	9.614E-15	354	0.234	0.203	1k9yA.pdb.gz	Structural enzymology of Li(+)-sensitive/Mg(2+)-dependent phosphatases.
19	PDB:7vceB	0.611	0.745	1.087E-13	249	0.185	0.229	7vceB.pdb.gz
20	PDB:5djfA	0.620	0.710	6.407E-13	266	0.179	0.207	5djfA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95861	0.0	634	308	1.000	1.000	BPNT1_HUMAN 3'(2'),5'-bisphosphate nucleotidase 1 OS=Homo sapiens OX=9606 GN=BPNT1 PE=1 SV=1
2	Q9Z0S1	0.0	590	308	0.919	0.919	BPNT1_MOUSE 3'(2'),5'-bisphosphate nucleotidase 1 OS=Mus musculus OX=10090 GN=Bpnt1 PE=1 SV=2
3	Q9Z1N4	0.0	582	308	0.912	0.912	BPNT1_RAT 3'(2'),5'-bisphosphate nucleotidase 1 OS=Rattus norvegicus OX=10116 GN=Bpnt1 PE=1 SV=1
4	Q23493	5.31e-71	224	319	0.451	0.436	Q23493_CAEEL 3'(2'),5'-bisphosphate nucleotidase 1 OS=Caenorhabditis elegans OX=6239 GN=bpnt-1 PE=1 SV=1
5	Q9VYF2	1.64e-32	125	355	0.305	0.265	IMPA3_DROME Putative inositol monophosphatase 3 OS=Drosophila melanogaster OX=7227 GN=CG15743 PE=2 SV=1
6	Q80V26	2.29e-24	103	356	0.289	0.250	IMPA3_MOUSE Golgi-resident adenosine 3',5'-bisphosphate 3'-phosphatase OS=Mus musculus OX=10090 GN=Bpnt2 PE=1 SV=1
7	Q9NX62	8.95e-24	101	359	0.299	0.256	IMPA3_HUMAN Golgi-resident adenosine 3',5'-bisphosphate 3'-phosphatase OS=Homo sapiens OX=9606 GN=BPNT2 PE=1 SV=1
8	P21327	3.09e-14	74.7	400	0.247	0.190	INPP_BOVIN Inositol polyphosphate 1-phosphatase OS=Bos taurus OX=9913 GN=INPP1 PE=1 SV=2
9	P49441	5.40e-14	73.9	399	0.244	0.188	INPP_HUMAN Inositol polyphosphate 1-phosphatase OS=Homo sapiens OX=9606 GN=INPP1 PE=1 SV=1
10	O76455	8.08e-12	67.4	375	0.198	0.163	O76455_DROME Inositol polyphosphate 1-phosphatase OS=Drosophila melanogaster OX=7227 GN=Ipp PE=2 SV=1
11	Q9VFP6	9.03e-12	67.4	375	0.198	0.163	Q9VFP6_DROME Inositol polyphosphate 1-phosphatase OS=Drosophila melanogaster OX=7227 GN=Ipp PE=1 SV=1
12	Q57YS3	8.92e-11	64.3	390	0.253	0.200	Q57YS3_TRYB2 Inositol polyphosphate 1-phosphatase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.10K10.600 PE=3 SV=1
13	P0ADG4	1.82e-07	53.5	267	0.218	0.251	SUHB_ECOLI Nus factor SuhB OS=Escherichia coli (strain K12) OX=83333 GN=suhB PE=1 SV=1
14	O14732	1.88e-07	53.9	288	0.240	0.257	IMPA2_HUMAN Inositol monophosphatase 2 OS=Homo sapiens OX=9606 GN=IMPA2 PE=1 SV=1
15	P54927	3.87e-07	52.8	265	0.211	0.245	IMP2_SOLLC Inositol monophosphatase 2 OS=Solanum lycopersicum OX=4081 GN=IMP2 PE=1 SV=1
16	Q19420	1.08e-06	51.6	285	0.201	0.218	IMPA1_CAEEL Inositol monophosphatase ttx-7 OS=Caenorhabditis elegans OX=6239 GN=ttx-7 PE=1 SV=3
17	Q91UZ5	1.93e-06	50.8	290	0.234	0.248	IMPA2_MOUSE Inositol monophosphatase 2 OS=Mus musculus OX=10090 GN=Impa2 PE=1 SV=1
18	Q8NS80	3.62e-06	49.7	260	0.166	0.196	HISN_CORGL Histidinol-phosphatase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=hisN PE=1 SV=1
19	P54928	5.47e-06	49.3	268	0.221	0.254	IMP3_SOLLC Inositol monophosphatase 3 OS=Solanum lycopersicum OX=4081 GN=IMP3 PE=1 SV=1
20	P20456	1.18e-05	48.1	277	0.214	0.238	IMPA1_BOVIN Inositol monophosphatase 1 OS=Bos taurus OX=9913 GN=IMPA1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10981 DUF2788	1.9e+02	13.5	Protein of unknown function (DUF2788)
2	PF00459 Inositol_P	1.8e-56	203.3	Inositol monophosphatase family
3	PF00390 malic	5.3e+02	11.8	Malic enzyme, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000446828

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265174	0.949	Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1
2	9606.ENSP00000406157	0.948	Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2
3	9606.ENSP00000262644	0.855	Inositol monophosphatase 3
4	9606.ENSP00000344393	0.780	rRNA-processing protein FCF1 homolog
5	9606.ENSP00000355777	0.772	Golgi resident protein GCP60
6	9606.ENSP00000323435	0.748	Sorting nexin-22
7	9606.ENSP00000383840	0.721	Methylmalonic aciduria and homocystinuria type C protein
8	9606.ENSP00000362334	0.715	Proteasome subunit beta type-2
9	9606.ENSP00000355747	0.670	Presenilin-2
10	9606.ENSP00000355890	0.648	Bifunctional glutamate/proline--tRNA ligase
11	9606.ENSP00000284476	0.609	Protein dispatched homolog 1
12	9606.ENSP00000324343	0.591	Beta-ureidopropionase
13	9606.ENSP00000408526	0.544	Inositol monophosphatase 1
14	9606.ENSP00000258281	0.542	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L
15	9606.ENSP00000382595	0.528	Multifunctional protein ADE2
16	9606.ENSP00000273598	0.526	Nicolin-1
17	9606.ENSP00000474090	0.513	Uridine phosphorylase 2
18	9606.ENSP00000346389	0.510	Myocyte-specific enhancer factor 2A
19	9606.ENSP00000371253	0.502	Trifunctional purine biosynthetic protein adenosine-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008252	1.000	nucleotidase activity
GO:0008441	0.991	3'(2'),5'-bisphosphate nucleotidase activity
GO:0005488	0.959	binding
GO:0043167	0.751	ion binding
GO:0052745	0.715	inositol phosphate phosphatase activity
GO:0046872	0.551	metal ion binding
GO:0000287	0.543	magnesium ion binding
GO:0005515	0.430	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044237	0.998	cellular metabolic process
GO:0044238	0.994	primary metabolic process
GO:1901564	0.993	organonitrogen compound metabolic process
GO:1901360	0.987	organic cyclic compound metabolic process
GO:0019637	0.986	organophosphate metabolic process
GO:0044281	0.985	small molecule metabolic process
GO:0046483	0.985	heterocycle metabolic process
GO:0006753	0.977	nucleoside phosphate metabolic process
GO:0009259	0.967	ribonucleotide metabolic process
GO:0009150	0.958	purine ribonucleotide metabolic process
GO:0006790	0.947	sulfur compound metabolic process
GO:0033865	0.907	nucleoside bisphosphate metabolic process
GO:0006082	0.708	organic acid metabolic process
GO:0043436	0.662	oxoacid metabolic process
GO:0033875	0.532	ribonucleoside bisphosphate metabolic process
GO:0034032	0.531	purine nucleoside bisphosphate metabolic process
GO:0032501	0.455	multicellular organismal process
GO:0032502	0.414	developmental process
GO:0048856	0.403	anatomical structure development
GO:0007275	0.392	multicellular organism development
GO:0050427	0.309	3'-phosphoadenosine 5'-phosphosulfate metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043227	0.943	membrane-bounded organelle
GO:0043231	0.934	intracellular membrane-bounded organelle
GO:0005634	0.716	nucleus
GO:0070013	0.510	intracellular organelle lumen
GO:0031981	0.442	nuclear lumen
GO:0005654	0.405	nucleoplasm
GO:0016020	0.392	membrane
GO:0031982	0.314	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:22140	1.000	a nucleoside 5'-phosphate + H2O = a nucleoside + phosphate
RHEA:10040	0.991	adenosine 3',5'-bisphosphate + H2O = AMP + phosphate
EC:3.1.3.7	0.991	3'(2'),5'-bisphosphate nucleotidase.

[back to server]