StarFunc result for job id O95863

User Input

>input (264 residues)
MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLPMLI
WDSVLAPQAQPIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSS
LEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPC
VCGTCGKAFSRPWLLQGHVRTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQA
CARTFSRMSLLHKHQESGCSGCPR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95863	1.000	1.000	8.263E-46	264	1.000	1.000	O95863.pdb.gz	SNAI1_HUMAN Zinc finger protein SNAI1 OS=Homo sapiens OX=9606 GN=SNAI1 PE=1 SV=2
2	AFDB:Q3KNW1	0.406	0.369	1.873E-19	292	0.462	0.418	Q3KNW1.pdb.gz	SNAI3_HUMAN Zinc finger protein SNAI3 OS=Homo sapiens OX=9606 GN=SNAI3 PE=2 SV=1
3	AFDB:Q90414	0.387	0.397	5.401E-19	257	0.504	0.518	Q90414.pdb.gz
4	AFDB:P25932	0.422	0.240	9.798E-19	470	0.413	0.232	P25932.pdb.gz	ESCA_DROME Protein escargot OS=Drosophila melanogaster OX=7227 GN=esg PE=1 SV=2
5	AFDB:Q8BTH6	0.399	0.341	4.551E-17	311	0.360	0.305	Q8BTH6.pdb.gz	SCRT2_MOUSE Transcriptional repressor scratch 2 OS=Mus musculus OX=10090 GN=Scrt2 PE=2 SV=2
6	AFDB:Q8SXL3	0.392	0.200	4.863E-17	548	0.466	0.224	Q8SXL3.pdb.gz	Q8SXL3_DROME RE10012p OS=Drosophila melanogaster OX=7227 GN=wor PE=2 SV=1
7	PDB:3w5kB	0.194	0.379	6.635E-14	110	0.417	1.000	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
8	AFDB:G5ECN8	0.398	0.389	1.582E-12	270	0.273	0.267	G5ECN8.pdb.gz	G5ECN8_CAEEL C2H2-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ces-1 PE=1 SV=1
9	AFDB:O60765	0.327	0.158	5.207E-12	605	0.250	0.109	O60765.pdb.gz	Z354A_HUMAN Zinc finger protein 354A OS=Homo sapiens OX=9606 GN=ZNF354A PE=1 SV=2
10	AFDB:Q96HQ0	0.331	0.185	5.943E-12	510	0.258	0.133	Q96HQ0.pdb.gz	ZN419_HUMAN Zinc finger protein 419 OS=Homo sapiens OX=9606 GN=ZNF419 PE=1 SV=2
11	AFDB:Q9VQS7	0.183	0.105	9.445E-12	578	0.307	0.140	Q9VQS7.pdb.gz	SOB_DROME Protein sister of odd and bowel OS=Drosophila melanogaster OX=7227 GN=sob PE=2 SV=1
12	PDB:6gejS	0.110	0.139	7.417E-1	208	0.125	0.159	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
13	PDB:6tutP	0.085	0.099	1.103	196	0.080	0.107	6tutP.pdb.gz	Structural basis for RNA polymerase III transcription repression by Maf1.
14	PDB:7pmkQ	0.063	0.032	1.103	766	0.083	0.029	7pmkQ.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
15	PDB:6ydhA	0.061	0.203	1.179	62	0.053	0.226	6ydhA.pdb.gz
16	PDB:7uhyA	0.089	0.042	1.438	771	0.083	0.029	7uhyA.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
17	PDB:5dkaA	0.099	0.222	1.536	96	0.068	0.188	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
18	PDB:7evoC	0.111	0.079	1.753	422	0.061	0.038	7evoC.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
19	PDB:5gm6f	0.096	0.186	1.873	102	0.053	0.137	5gm6f.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
20	PDB:5apnp	0.081	0.194	2.787	91	0.027	0.077	5apnp.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95863	0.0	541	264	1.000	1.000	SNAI1_HUMAN Zinc finger protein SNAI1 OS=Homo sapiens OX=9606 GN=SNAI1 PE=1 SV=2
2	Q6AY35	1.57e-158	442	264	0.890	0.890	Q6AY35_RAT Snail homolog 1 (Drosophila) OS=Rattus norvegicus OX=10116 GN=Snai1 PE=2 SV=1
3	Q02085	2.77e-156	437	264	0.875	0.875	SNAI1_MOUSE Zinc finger protein SNAI1 OS=Mus musculus OX=10090 GN=Snai1 PE=1 SV=1
4	A0A8J8YBT6	9.95e-108	318	385	0.674	0.462	A0A8J8YBT6_RAT Snail family transcriptional repressor 1 OS=Rattus norvegicus OX=10116 GN=Snai1 PE=4 SV=1
5	P19382	8.49e-91	271	259	0.568	0.579	SNAI1_XENLA Protein snail homolog Sna OS=Xenopus laevis OX=8355 GN=snai1 PE=1 SV=1
6	O43623	2.77e-85	257	268	0.545	0.537	SNAI2_HUMAN Zinc finger protein SNAI2 OS=Homo sapiens OX=9606 GN=SNAI2 PE=1 SV=1
7	O08954	3.02e-85	257	268	0.568	0.560	SNAI2_RAT Zinc finger protein SNAI2 OS=Rattus norvegicus OX=10116 GN=Snai2 PE=2 SV=2
8	P97469	1.09e-84	256	269	0.542	0.532	SNAI2_MOUSE Zinc finger protein SNAI2 OS=Mus musculus OX=10090 GN=Snai2 PE=1 SV=1
9	Q91924	3.86e-83	251	266	0.542	0.538	SNAI2_XENLA Zinc finger protein SNAI2 OS=Xenopus laevis OX=8355 GN=snai2 PE=1 SV=1
10	Q91051	5.53e-83	251	268	0.542	0.534	Q91051_9GALL Slug protein OS=Gallus sp. OX=9036 GN=Slug PE=2 SV=1
11	Q90274	2.17e-67	211	260	0.527	0.535	Q90274_DANRE Sna-1 protein OS=Danio rerio OX=7955 GN=sna1 PE=2 SV=1
12	B3DH44	4.84e-67	210	256	0.515	0.531	B3DH44_DANRE LOC792194 protein OS=Danio rerio OX=7955 GN=LOC792194 PE=2 SV=1
13	Q9QY31	9.85e-64	202	287	0.496	0.456	SNAI3_MOUSE Zinc finger protein SNAI3 OS=Mus musculus OX=10090 GN=Snai3 PE=2 SV=1
14	Q3KNW1	1.97e-62	199	292	0.345	0.312	SNAI3_HUMAN Zinc finger protein SNAI3 OS=Homo sapiens OX=9606 GN=SNAI3 PE=2 SV=1
15	Q8SXL3	1.81e-59	199	548	0.345	0.166	Q8SXL3_DROME RE10012p OS=Drosophila melanogaster OX=7227 GN=wor PE=2 SV=1
16	Q9U7P8	1.81e-59	199	548	0.345	0.166	Q9U7P8_DROME Zinc finger protein Worniu OS=Drosophila melanogaster OX=7227 GN=wor PE=2 SV=1
17	Q9VJP2	1.81e-59	199	548	0.345	0.166	Q9VJP2_DROME Worniu OS=Drosophila melanogaster OX=7227 GN=wor PE=4 SV=1
18	P25932	2.64e-59	197	470	0.345	0.194	ESCA_DROME Protein escargot OS=Drosophila melanogaster OX=7227 GN=esg PE=1 SV=2
19	P08044	1.81e-53	179	390	0.299	0.203	SNAI_DROME Protein snail OS=Drosophila melanogaster OX=7227 GN=sna PE=1 SV=2
20	Q8BTH6	1.02e-42	149	311	0.254	0.215	SCRT2_MOUSE Transcriptional repressor scratch 2 OS=Mus musculus OX=10090 GN=Scrt2 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05129 Elf1	2.7	19.4	Transcription elongation factor Elf1 like
2	PF01155 HypA	5.8e+02	11.9	Hydrogenase/urease nickel incorporation, metallochaperone, hypA
3	PF01428 zf-AN1	2.9e+02	13.0	AN1-like Zinc finger
4	PF00096 zf-C2H2	4.1e-13	60.1	Zinc finger, C2H2 type
5	PF12756 zf-C2H2_2	45	15.8	C2H2 type zinc-finger (2 copies)
6	PF13894 zf-C2H2_4	2.4e-11	54.4	C2H2-type zinc finger
7	PF13912 zf-C2H2_6	0.0032	28.7	C2H2-type zinc finger
8	PF12171 zf-C2H2_jaz	3.1e-10	51.3	Zinc-finger double-stranded RNA-binding
9	PF16278 zf-C2HE	0.39	22.5	C2HE / C2H2 / C2HC zinc-binding finger
10	PF05605 zf-Di19	0.024	26.3	Drought induced 19 protein (Di19), zinc-binding
11	PF13465 zf-H2C2_2	8.3e-12	56.2	Zinc-finger double domain
12	PF13909 zf-H2C2_5	82	14.4	C2H2-type zinc-finger domain
13	PF12874 zf-met	0.041	25.5	Zinc-finger of C2H2 type
14	PF17032 zinc_ribbon_15	1.1e+02	15.0	zinc-ribbon family
15	PF09723 Zn-ribbon_8	85	14.7	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000244050

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362649	0.999	Histone deacetylase 1
2	9606.ENSP00000383042	0.999	Lysine-specific histone demethylase 1A
3	9606.ENSP00000320147	0.998	Histone-lysine N-methyltransferase EZH2
4	9606.ENSP00000430432	0.998	Histone deacetylase 2
5	9606.ENSP00000269305	0.996	Cellular tumor antigen p53
6	9606.ENSP00000359206	0.994	F-box/WD repeat-containing protein 1A
7	9606.ENSP00000261769	0.993	Cadherin-1
8	9606.ENSP00000262241	0.993	REST corepressor 1
9	9606.ENSP00000352516	0.992	DNA (cytosine-5)-methyltransferase 1
10	9606.ENSP00000332973	0.990	Mothers against decapentaplegic homolog 3
11	9606.ENSP00000319169	0.989	Protein arginine N-methyltransferase 5
12	9606.ENSP00000364678	0.989	Histone-lysine N-methyltransferase EHMT2
13	9606.ENSP00000373783	0.986	Lysyl oxidase homolog 2
14	9606.ENSP00000378402	0.983	Paired amphipathic helix protein Sin3a
15	9606.ENSP00000324806	0.982	Glycogen synthase kinase-3 beta
16	9606.ENSP00000341551	0.976	Mothers against decapentaplegic homolog 4
17	9606.ENSP00000337976	0.961	Histone-lysine N-methyltransferase SUV39H1
18	9606.ENSP00000344456	0.957	Catenin beta-1
19	9606.ENSP00000383973	0.955	Metastasis-associated protein MTA3
20	9606.ENSP00000290921	0.944	C-terminal-binding protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000978	1.000	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001227	0.999	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0070888	0.978	E-box binding
GO:0019899	0.942	enzyme binding
GO:0019900	0.735	kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0009987	0.995	cellular process
GO:0009892	0.978	negative regulation of metabolic process
GO:0031324	0.968	negative regulation of cellular metabolic process
GO:0048856	0.965	anatomical structure development
GO:0010468	0.945	regulation of gene expression
GO:0010556	0.941	regulation of macromolecule biosynthetic process
GO:0031326	0.941	regulation of cellular biosynthetic process
GO:0051172	0.938	negative regulation of nitrogen compound metabolic process
GO:0051252	0.936	regulation of RNA metabolic process
GO:0009890	0.933	negative regulation of biosynthetic process
GO:0001837	0.933	epithelial to mesenchymal transition
GO:0006355	0.932	regulation of DNA-templated transcription
GO:0050896	0.916	response to stimulus
GO:0048518	0.895	positive regulation of biological process
GO:0010605	0.890	negative regulation of macromolecule metabolic process
GO:0048522	0.882	positive regulation of cellular process
GO:0045934	0.876	negative regulation of nucleobase-containing compound metabolic process
GO:0009893	0.855	positive regulation of metabolic process
GO:0010604	0.847	positive regulation of macromolecule metabolic process
GO:0051716	0.844	cellular response to stimulus
GO:0032501	0.841	multicellular organismal process
GO:0031327	0.833	negative regulation of cellular biosynthetic process
GO:0007275	0.827	multicellular organism development
GO:0031325	0.818	positive regulation of cellular metabolic process
GO:0051173	0.815	positive regulation of nitrogen compound metabolic process
GO:0051253	0.779	negative regulation of RNA metabolic process
GO:0048731	0.774	system development
GO:0010558	0.755	negative regulation of macromolecule biosynthetic process
GO:0045892	0.741	negative regulation of DNA-templated transcription
GO:0007154	0.728	cell communication
GO:0009653	0.724	anatomical structure morphogenesis
GO:0007165	0.689	signal transduction
GO:0006357	0.670	regulation of transcription by RNA polymerase II
GO:0031328	0.665	positive regulation of cellular biosynthetic process
GO:0010557	0.658	positive regulation of macromolecule biosynthetic process
GO:0045935	0.658	positive regulation of nucleobase-containing compound metabolic process
GO:0048583	0.651	regulation of response to stimulus
GO:1902680	0.651	positive regulation of RNA biosynthetic process
GO:1903508	0.642	positive regulation of nucleic acid-templated transcription
GO:0007166	0.632	cell surface receptor signaling pathway
GO:0045893	0.628	positive regulation of DNA-templated transcription
GO:0050793	0.581	regulation of developmental process
GO:0045595	0.530	regulation of cell differentiation
GO:0009966	0.528	regulation of signal transduction
GO:0051239	0.513	regulation of multicellular organismal process
GO:0010941	0.431	regulation of cell death
GO:1902531	0.401	regulation of intracellular signal transduction
GO:0030334	0.382	regulation of cell migration
GO:0042981	0.359	regulation of apoptotic process
GO:0060548	0.339	negative regulation of cell death
GO:0048585	0.334	negative regulation of response to stimulus
GO:0000122	0.332	negative regulation of transcription by RNA polymerase II
GO:0080134	0.330	regulation of response to stress
GO:0072359	0.319	circulatory system development
GO:0042127	0.300	regulation of cell population proliferation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005829	0.969	cytosol
GO:0043232	0.969	intracellular non-membrane-bounded organelle
GO:0005694	0.933	chromosome
GO:0000785	0.752	chromatin
GO:0098687	0.585	chromosomal region
GO:0000792	0.516	heterochromatin
GO:0005730	0.489	nucleolus
GO:0000775	0.396	chromosome, centromeric region
GO:0005721	0.357	pericentric heterochromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]