StarFunc result for job id O95865

User Input

>input (285 residues)
MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGGKLRQRLGLQL
LELPPEESLPLGPLLGDTAVIQGDTALITRPWSPARRPEVDGVRKALQDLGLRIVEIGDE
NATLDGTDVLFTGREFFVGLSKWTNHRGAEIVADTFRDFAVSTVPVSGPSHLRGLCGMGG
PRTVVAGSSDAAQKAVRAMAVLTDHPYASLTLPDDAAADCLFLRPGLPGVPPFLLHRGGG
DLPNSQEALQKLSDVTLVPVSCSELEKAGAGLSSLCLVLSTRPHS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95865	1.000	1.000	3.699E-64	285	1.000	1.000	O95865.pdb.gz	DDAH2_HUMAN N(G),N(G)-dimethylarginine dimethylaminohydrolase 2 OS=Homo sapiens OX=9606 GN=DDAH2 PE=1 SV=1
2	AFDB:O08557	0.950	0.950	1.245E-38	285	0.484	0.484	O08557.pdb.gz	DDAH1_RAT N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 OS=Rattus norvegicus OX=10116 GN=Ddah1 PE=1 SV=3
3	PDB:6szqD	0.924	0.921	1.147E-35	286	0.488	0.486	6szqD.pdb.gz
4	AFDB:P71889	0.708	0.672	6.241E-15	302	0.196	0.185	P71889.pdb.gz	DDAH_MYCTU N(G),N(G)-dimethylarginine dimethylaminohydrolase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2323c PE=1 SV=1
5	AFDB:Q389F5	0.770	0.714	5.789E-14	310	0.179	0.165	Q389F5.pdb.gz	Q389F5_TRYB2 Mitochondrial RNA binding protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.1910 PE=4 SV=1
6	PDB:1jdxA	0.714	0.576	1.003E-11	360	0.161	0.128	1jdxA.pdb.gz	The ligand-induced structural changes of human L-Arginine:Glycine amidinotransferase. A mutational and crystallographic study.
7	AFDB:F4ZCI3	0.733	0.566	4.620E-11	379	0.161	0.121	F4ZCI3.pdb.gz	NNHA_MYCS0 2-nitroimidazole nitrohydrolase OS=Mycobacterium sp. (strain JS330) OX=1004011 GN=nnhA PE=1 SV=1
8	AFDB:A0A140VK19	0.705	0.490	9.124E-11	423	0.165	0.111	A0A140VK19.pdb.gz	A0A140VK19_HUMAN Glycine amidinotransferase OS=Homo sapiens OX=9606 PE=2 SV=1
9	AFDB:P9WQ05	0.689	0.506	1.802E-10	402	0.221	0.157	P9WQ05.pdb.gz	ARCA_MYCTU Arginine deiminase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=arcA PE=1 SV=1
10	AFDB:Q5E7U3	0.728	0.526	2.423E-9	406	0.207	0.145	Q5E7U3.pdb.gz	ARCA_ALIF1 Arginine deiminase OS=Aliivibrio fischeri (strain ATCC 700601 / ES114) OX=312309 GN=arcA PE=3 SV=1
11	AFDB:P13981	0.667	0.472	3.975E-9	418	0.211	0.144	P13981.pdb.gz	ARCA_PSEAE Arginine deiminase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=arcA PE=1 SV=2
12	AFDB:Q9I6J9	0.585	0.471	1.070E-8	368	0.165	0.128	Q9I6J9.pdb.gz	AGUA_PSEAE Agmatine deiminase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=aguA PE=1 SV=1
13	PDB:3h7cX	0.620	0.496	1.581E-8	369	0.158	0.122	3h7cX.pdb.gz	Structural Insights into the Catalytic Mechanism of Arabidopsis thaliana Agmatine Deiminase
14	PDB:1rxxC	0.712	0.509	1.904E-8	412	0.207	0.143	1rxxC.pdb.gz
15	PDB:1ynhB	0.665	0.458	1.202E-6	440	0.130	0.084	1ynhB.pdb.gz	Crystal structure of N-succinylarginine dihydrolase AstB, bound to substrate and product, an enzyme from the arginine catabolic pathway of Escherichia coli.
16	PDB:5hp5A	0.571	0.274	5.848E-4	669	0.140	0.060	5hp5A.pdb.gz	Monomeric Form of Peptidylarginine Deiminase Type I Revealed by X-ray Crystallography and Small-Angle X-ray Scattering
17	PDB:5n0zA	0.550	0.273	1.229E-3	638	0.130	0.058	5n0zA.pdb.gz	Development of a Selective Inhibitor of Protein Arginine Deiminase 2.
18	PDB:5an9I	0.437	0.531	2.281E-3	224	0.081	0.103	5an9I.pdb.gz	Mechanism of Eif6 Release from the Nascent 60S Ribosomal Subunit
19	PDB:7d56C	0.568	0.280	4.235E-3	640	0.088	0.039	7d56C.pdb.gz	Structures of human peptidylarginine deiminase type III provide insights into substrate recognition and inhibitor design.
20	PDB:7ohxy	0.305	0.425	5.099E-3	189	0.063	0.095	7ohxy.pdb.gz	Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95865	0.0	561	285	1.000	1.000	DDAH2_HUMAN N(G),N(G)-dimethylarginine dimethylaminohydrolase 2 OS=Homo sapiens OX=9606 GN=DDAH2 PE=1 SV=1
2	Q3SX44	0.0	546	285	0.965	0.965	DDAH2_BOVIN N(G),N(G)-dimethylarginine dimethylaminohydrolase 2 OS=Bos taurus OX=9913 GN=DDAH2 PE=2 SV=1
3	Q6MG60	0.0	546	285	0.968	0.968	DDAH2_RAT N(G),N(G)-dimethylarginine dimethylaminohydrolase 2 OS=Rattus norvegicus OX=10116 GN=Ddah2 PE=1 SV=1
4	V9HW53	0.0	561	285	1.000	1.000	V9HW53_HUMAN dimethylargininase OS=Homo sapiens OX=9606 GN=HEL-S-277 PE=1 SV=1
5	Q5SRR8	3.22e-168	467	236	0.828	1.000	Q5SRR8_HUMAN dimethylargininase (Fragment) OS=Homo sapiens OX=9606 GN=DDAH2 PE=1 SV=2
6	Q5SSV3	1.86e-160	447	226	0.793	1.000	Q5SSV3_HUMAN dimethylargininase (Fragment) OS=Homo sapiens OX=9606 GN=DDAH2 PE=1 SV=1
7	O94760	4.24e-94	281	285	0.509	0.509	DDAH1_HUMAN N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 OS=Homo sapiens OX=9606 GN=DDAH1 PE=1 SV=3
8	Q9CWS0	2.34e-91	274	285	0.495	0.495	DDAH1_MOUSE N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 OS=Mus musculus OX=10090 GN=Ddah1 PE=1 SV=3
9	O08557	2.94e-91	274	285	0.488	0.488	DDAH1_RAT N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 OS=Rattus norvegicus OX=10116 GN=Ddah1 PE=1 SV=3
10	P56965	5.01e-91	273	285	0.488	0.488	DDAH1_BOVIN N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 OS=Bos taurus OX=9913 GN=DDAH1 PE=1 SV=3
11	Q86GV3	0.50	34.7	1276	0.074	0.016	GCY28_CAEEL Receptor-type guanylate cyclase gcy-28 OS=Caenorhabditis elegans OX=6239 GN=gcy-28 PE=1 SV=1
12	B2KTE1	1.8	32.7	2100	0.105	0.014	B2KTE1_DANRE 1-phosphatidylinositol-3-phosphate 5-kinase OS=Danio rerio OX=7955 GN=pip5k3 PE=2 SV=1
13	B2KTE2	1.8	32.7	2084	0.105	0.014	B2KTE2_DANRE 1-phosphatidylinositol-3-phosphate 5-kinase OS=Danio rerio OX=7955 GN=pip5k3 PE=2 SV=1
14	B2KTE3	1.8	32.7	2091	0.105	0.014	B2KTE3_DANRE 1-phosphatidylinositol-3-phosphate 5-kinase OS=Danio rerio OX=7955 GN=pip5k3 PE=2 SV=1
15	B2KTE4	1.8	32.7	2075	0.105	0.014	B2KTE4_DANRE 1-phosphatidylinositol-3-phosphate 5-kinase OS=Danio rerio OX=7955 GN=pip5k3 PE=2 SV=1
16	Q53971	3.9	31.6	1117	0.039	0.010	Q53971_STRDY Fibronectin binding protein OS=Streptococcus dysgalactiae OX=1334 GN=fnbB PE=1 SV=1
17	P22523	6.1	31.2	1486	0.088	0.017	MUKB_ECOLI Chromosome partition protein MukB OS=Escherichia coli (strain K12) OX=83333 GN=mukB PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000007608

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000005645	0.691	Myeloid leukemia factor 2
2	61853.ENSNLEP00000017414	0.691	ADP-ribosylation factor GTPase activating protein 2
3	61853.ENSNLEP00000007990	0.604	Activating transcription factor 6 beta
4	61853.ENSNLEP00000014207	0.601	yrdC N(6)-threonylcarbamoyltransferase domain containing
5	61853.ENSNLEP00000017602	0.573	Alanine--glyoxylate aminotransferase 2
6	61853.ENSNLEP00000004866	0.567	Nitric oxide synthase
7	61853.ENSNLEP00000009736	0.562	Target of myb1 (chicken)-like 1
8	61853.ENSNLEP00000005416	0.559	Synaptosomal-associated protein, 23kDa
9	61853.ENSNLEP00000015949	0.522	Delta-1-pyrroline-5-carboxylate synthase
10	61853.ENSNLEP00000019447	0.520	ADP-ribosylation factor GTPase activating protein 3
11	61853.ENSNLEP00000022029	0.520	Kinesin-like protein
12	61853.ENSNLEP00000006410	0.517	Protein arginine methyltransferase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0016403	0.999	dimethylargininase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.988	biological regulation
GO:0071704	0.988	organic substance metabolic process
GO:0009987	0.987	cellular process
GO:0044237	0.983	cellular metabolic process
GO:0050794	0.980	regulation of cellular process
GO:0044238	0.976	primary metabolic process
GO:0006807	0.974	nitrogen compound metabolic process
GO:1901564	0.953	organonitrogen compound metabolic process
GO:0006520	0.879	amino acid metabolic process
GO:0009064	0.829	glutamine family amino acid metabolic process
GO:0006525	0.774	arginine metabolic process
GO:0050896	0.608	response to stimulus
GO:0048519	0.589	negative regulation of biological process
GO:0048523	0.555	negative regulation of cellular process
GO:0048518	0.524	positive regulation of biological process
GO:0051716	0.502	cellular response to stimulus
GO:0019222	0.502	regulation of metabolic process
GO:0048522	0.484	positive regulation of cellular process
GO:0051171	0.457	regulation of nitrogen compound metabolic process
GO:0031323	0.457	regulation of cellular metabolic process
GO:0007154	0.420	cell communication
GO:0023052	0.418	signaling
GO:0009893	0.318	positive regulation of metabolic process
GO:0031325	0.306	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0005829	0.967	cytosol
GO:0005576	0.807	extracellular region
GO:0031982	0.756	vesicle
GO:0005615	0.750	extracellular space
GO:0070062	0.675	extracellular exosome
GO:0016020	0.406	membrane
GO:0070013	0.364	intracellular organelle lumen
GO:0012505	0.313	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:17305	0.999	H2O + N(omega),N(omega)-dimethyl-L-arginine = dimethylamine + L-citrulline
EC:3.5.3.18	0.999	dimethylargininase.

[back to server]