StarFunc result for job id O95881

User Input

>input (172 residues)
METRPRLGATCLLGFSFLLLVISSDGHNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVI
IHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDP
SGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHLEDEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95881	1.000	1.000	1.962E-35	172	1.000	1.000	O95881.pdb.gz	TXD12_HUMAN Thioredoxin domain-containing protein 12 OS=Homo sapiens OX=9606 GN=TXNDC12 PE=1 SV=1
2	AFDB:Q503D8	0.831	0.831	1.084E-27	172	0.721	0.721	Q503D8.pdb.gz	Q503D8_DANRE Thioredoxin domain-containing protein 12 OS=Danio rerio OX=7955 GN=TLP19 PE=1 SV=1
3	AFDB:H9D1R1	0.770	0.766	4.639E-26	173	0.692	0.688	H9D1R1.pdb.gz	TXD12_EPICO Thioredoxin domain-containing protein 12 OS=Epinephelus coioides OX=94232 GN=Txndc12 PE=1 SV=1
4	AFDB:Q8TD06	0.704	0.728	9.973E-14	166	0.343	0.355	Q8TD06.pdb.gz	AGR3_HUMAN Anterior gradient protein 3 OS=Homo sapiens OX=9606 GN=AGR3 PE=1 SV=1
5	AFDB:O88312	0.692	0.681	2.141E-13	175	0.326	0.320	O88312.pdb.gz	AGR2_MOUSE Anterior gradient protein 2 homolog OS=Mus musculus OX=10090 GN=Agr2 PE=1 SV=1
6	AFDB:P55869	0.675	0.631	3.343E-13	185	0.285	0.265	P55869.pdb.gz	AG2_XENLA Anterior gradient protein 2 OS=Xenopus laevis OX=8355 GN=ag2 PE=2 SV=3
7	PDB:3ph9B	0.681	0.858	7.018E-13	135	0.297	0.378	3ph9B.pdb.gz
8	AFDB:F1Q8B0	0.698	0.714	3.308E-12	168	0.302	0.310	F1Q8B0.pdb.gz	F1Q8B0_DANRE Ag1 OS=Danio rerio OX=7955 GN=ag1 PE=1 SV=1
9	AFDB:Q5RZ65	0.685	0.689	1.625E-11	171	0.291	0.292	Q5RZ65.pdb.gz	AGR2_DANRE Anterior gradient protein 2 homolog OS=Danio rerio OX=7955 GN=agr2 PE=2 SV=1
10	AFDB:F4JI63	0.450	0.123	4.552E-6	818	0.198	0.042	F4JI63.pdb.gz	F4JI63_ARATH Catalytics OS=Arabidopsis thaliana OX=3702 GN=At4g03200 PE=1 SV=1
11	AFDB:P36655	0.498	0.173	1.041E-5	565	0.140	0.042	P36655.pdb.gz	DSBD_ECOLI Thiol:disulfide interchange protein DsbD OS=Escherichia coli (strain K12) OX=83333 GN=dsbD PE=1 SV=4
12	PDB:5xocB	0.376	0.467	4.949E-4	133	0.122	0.158	5xocB.pdb.gz
13	PDB:4pufC	0.450	0.642	5.991E-4	112	0.122	0.188	4pufC.pdb.gz
14	PDB:1xwaA	0.459	0.666	7.728E-4	111	0.140	0.216	1xwaA.pdb.gz
15	PDB:6z7oA	0.464	0.676	9.970E-4	110	0.099	0.155	6z7oA.pdb.gz	Structures of the germline-specific Deadhead and thioredoxin T proteins from Drosophila melanogaster reveal unique features among thioredoxins.
16	PDB:2l4qA	0.398	0.554	1.132E-3	116	0.122	0.181	2l4qA.pdb.gz
17	PDB:4ekzA	0.443	0.186	1.132E-3	469	0.180	0.066	4ekzA.pdb.gz
18	PDB:6gd1A	0.390	0.357	1.286E-3	190	0.110	0.100	6gd1A.pdb.gz
19	PDB:7scdA	0.383	0.194	1.659E-3	371	0.116	0.054	7scdA.pdb.gz	Structural and Substrate Specificity Analysis of 3-O-Sulfotransferase Isoform 5 to Synthesize Heparan Sulfate
20	PDB:4j56E	0.366	0.553	2.008E-3	105	0.081	0.133	4j56E.pdb.gz	Crystal Structure of the Plasmodium falciparum Thioredoxin Reductase-Thioredoxin Complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95881	1.49e-127	357	172	1.000	1.000	TXD12_HUMAN Thioredoxin domain-containing protein 12 OS=Homo sapiens OX=9606 GN=TXNDC12 PE=1 SV=1
2	Q9CQU0	2.05e-99	285	170	0.901	0.912	TXD12_MOUSE Thioredoxin domain-containing protein 12 OS=Mus musculus OX=10090 GN=Txndc12 PE=1 SV=1
3	Q498E0	2.14e-98	283	170	0.895	0.906	TXD12_RAT Thioredoxin domain-containing protein 12 OS=Rattus norvegicus OX=10116 GN=Txndc12 PE=2 SV=2
4	H9D1R1	2.50e-90	263	173	0.692	0.688	TXD12_EPICO Thioredoxin domain-containing protein 12 OS=Epinephelus coioides OX=94232 GN=Txndc12 PE=1 SV=1
5	Q503D8	3.74e-89	259	172	0.698	0.698	Q503D8_DANRE Thioredoxin domain-containing protein 12 OS=Danio rerio OX=7955 GN=TLP19 PE=1 SV=1
6	Q8TD06	1.39e-24	95.5	166	0.343	0.355	AGR3_HUMAN Anterior gradient protein 3 OS=Homo sapiens OX=9606 GN=AGR3 PE=1 SV=1
7	B5MC62	1.48e-23	92.8	163	0.326	0.344	B5MC62_HUMAN Anterior gradient 3, protein disulphide isomerase family member OS=Homo sapiens OX=9606 GN=AGR3 PE=1 SV=1
8	O95994	1.15e-22	90.9	175	0.291	0.286	AGR2_HUMAN Anterior gradient protein 2 homolog OS=Homo sapiens OX=9606 GN=AGR2 PE=1 SV=1
9	O88312	8.98e-22	88.6	175	0.297	0.291	AGR2_MOUSE Anterior gradient protein 2 homolog OS=Mus musculus OX=10090 GN=Agr2 PE=1 SV=1
10	H7C040	1.03e-21	87.0	129	0.285	0.380	H7C040_HUMAN Anterior gradient 3, protein disulphide isomerase family member (Fragment) OS=Homo sapiens OX=9606 GN=AGR3 PE=1 SV=1
11	Q5RZ65	5.09e-20	84.0	171	0.279	0.281	AGR2_DANRE Anterior gradient protein 2 homolog OS=Danio rerio OX=7955 GN=agr2 PE=2 SV=1
12	F1Q8B0	5.23e-20	84.0	168	0.279	0.286	F1Q8B0_DANRE Ag1 OS=Danio rerio OX=7955 GN=ag1 PE=1 SV=1
13	P55869	4.14e-18	79.3	185	0.279	0.259	AG2_XENLA Anterior gradient protein 2 OS=Xenopus laevis OX=8355 GN=ag2 PE=2 SV=3
14	O23166	1.58e-04	43.1	261	0.163	0.107	TR164_ARATH Thioredoxin-like protein HCF164, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=HCF164 PE=1 SV=2
15	Q582M8	8.17e-04	40.4	198	0.163	0.141	Q582M8_TRYB2 Tryparedoxin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48K5.910 PE=4 SV=1
16	O51088	0.002	38.1	117	0.134	0.197	THIO_BORBU Thioredoxin OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=trxA PE=3 SV=1
17	Q17424	0.003	38.5	145	0.093	0.110	THIO2_CAEEL Probable thioredoxin-2 OS=Caenorhabditis elegans OX=6239 GN=trx-2 PE=3 SV=2
18	Q13087	0.004	38.9	525	0.110	0.036	PDIA2_HUMAN Protein disulfide-isomerase A2 OS=Homo sapiens OX=9606 GN=PDIA2 PE=1 SV=2
19	Q53LQ0	0.007	38.5	512	0.122	0.041	PDI11_ORYSJ Protein disulfide isomerase-like 1-1 OS=Oryza sativa subsp. japonica OX=39947 GN=PDIL1-1 PE=2 SV=1
20	Q3YMU0	0.008	38.1	489	0.145	0.051	Q3YMU0_DROME Protein disulfide-isomerase (Fragment) OS=Drosophila melanogaster OX=7227 GN=ERp60 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00578 AhpC-TSA	4.8e+02	12.1	AhpC/TSA family
2	PF00085 Thioredoxin	0.088	24.2	Thioredoxin
3	PF13098 Thioredoxin_2	2	20.3	Thioredoxin-like domain
4	PF13899 Thioredoxin_7	2.3e-13	61.4	Thioredoxin-like
5	PF13905 Thioredoxin_8	2.6e+02	13.3	Thioredoxin-like
6	PF14595 Thioredoxin_9	2.3e+02	13.0	Thioredoxin
7	PF03190 Thioredox_DsbH	24	16.3	Protein of unknown function, DUF255

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360688

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000338964	0.918	Glutathione hydrolase 7
2	9606.ENSP00000370962	0.918	Glutathione hydrolase 6
3	9606.ENSP00000381340	0.911	Glutathione hydrolase 5 proenzyme
4	9606.ENSP00000383232	0.907	Glutathione hydrolase 1 proenzyme
5	9606.ENSP00000216951	0.903	Glutathione synthetase
6	9606.ENSP00000295304	0.900	Glutathione-specific gamma-glutamylcyclotransferase 2
7	9606.ENSP00000398105	0.900	Glutathione-specific gamma-glutamylcyclotransferase 1
8	9606.ENSP00000246024	0.735	Thioredoxin related transmembrane protein 4
9	9606.ENSP00000299608	0.706	Protein disulfide-isomerase TMX3
10	9606.ENSP00000264607	0.702	Ankyrin repeat and SOCS box protein 1
11	9606.ENSP00000397249	0.702	Basic leucine zipper and W2 domain-containing protein 2
12	9606.ENSP00000356864	0.694	Microsomal glutathione S-transferase 3
13	9606.ENSP00000281871	0.691	Mitotic spindle organizing protein 2B
14	9606.ENSP00000358851	0.689	Glutathione S-transferase Mu 4
15	9606.ENSP00000379512	0.688	Microsomal glutathione S-transferase 1
16	9606.ENSP00000251413	0.686	Tubulin gamma-1 chain
17	9606.ENSP00000241337	0.685	Glutathione S-transferase Mu 2
18	9606.ENSP00000290765	0.685	Glutathione S-transferase theta-2B
19	9606.ENSP00000262067	0.678	Tetraspanin-13
20	9606.ENSP00000480316	0.675	Gamma-tubulin complex component 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0015035	1.000	protein-disulfide reductase activity
GO:0016671	0.999	oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor
GO:0019153	0.384	protein-disulfide reductase (glutathione) activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.927	regulation of biological process
GO:0050794	0.843	regulation of cellular process
GO:0009987	0.832	cellular process
GO:0048519	0.787	negative regulation of biological process
GO:0048523	0.778	negative regulation of cellular process
GO:0008152	0.697	metabolic process
GO:0048583	0.685	regulation of response to stimulus
GO:0071704	0.680	organic substance metabolic process
GO:0080135	0.609	regulation of cellular response to stress
GO:0042981	0.551	regulation of apoptotic process
GO:2001233	0.543	regulation of apoptotic signaling pathway
GO:1905897	0.527	regulation of response to endoplasmic reticulum stress
GO:1902531	0.514	regulation of intracellular signal transduction
GO:0044237	0.507	cellular metabolic process
GO:2001242	0.486	regulation of intrinsic apoptotic signaling pathway
GO:0060548	0.480	negative regulation of cell death
GO:0048585	0.434	negative regulation of response to stimulus
GO:0050896	0.429	response to stimulus
GO:0023057	0.427	negative regulation of signaling
GO:0010648	0.427	negative regulation of cell communication
GO:0009968	0.416	negative regulation of signal transduction
GO:0043069	0.411	negative regulation of programmed cell death
GO:0043066	0.339	negative regulation of apoptotic process
GO:2001234	0.331	negative regulation of apoptotic signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070013	1.000	intracellular organelle lumen
GO:0005783	1.000	endoplasmic reticulum
GO:0005788	0.994	endoplasmic reticulum lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.8.4.-	0.999	With a disulfide as acceptor.
RHEA:21064	0.384	[protein]-disulfide + 2 glutathione = [protein]-dithiol + glutathione disulfide
EC:1.8.4.2	0.384	protein-disulfide reductase (glutathione).

[back to server]