StarFunc result for job id O95886

User Input

>input (979 residues)
MRGYHGDRGSHPRPARFADQQHMDVGPAARAPYLLGSREAFSTEPRFCAPRAGLGHISPE
GPLSLSEGPSVGPEGGPAGAGVGGGSSTFPRMYPGQGPFDTCEDCVGHPQGKGAPRLPPT
LLDQFEKQLPVQQDGFHTLPYQRGPAGAGPGPAPGTGTAPEPRSESPSRIRHLVHSVQKL
FAKSHSLEAPGKRDYNGPKAEGRGGSGGDSYPGPGSGGPHTSHHHHHHHHHHHHQSRHGK
RSKSKDRKGDGRHQAKSTGWWSSDDNLDSDSGFLAGGRPPGEPGGPFCLEGPDGSYRDLS
FKGRSGGSEGRCLACTGMSMSLDGQSVKRSAWHTMMVSQGRDGYPGAGPGKGLLGPETKA
KARTYHYLQVPQDDWGGYPTGGKDGEIPCRRMRSGSYIKAMGDEESGDSDGSPKTSPKAV
ARRFTTRRSSSVDQARINCCVPPRIHPRSSIPGYSRSLTTGQLSDELNQQLEAVCGSVFG
ELESQAVDALDLPGCFRMRSHSYLRAIQAGCSQDDDCLPLLATPAAVSGRPGSSFNFRKA
PPPIPPGSQAPPRISITAQSSTDSAHESFTAAEGPARRCSSADGLDGPAMGARTLELAPV
PPRASPKPPTLIIKTIPGREELRSLARQRKWRPSIGVQVETISDSDTENRSRREFHSIGV
QVEEDKRRARFKRSNSVTAGVQADLELEGLAGLATVATEDKALQFGRSFQRHASEPQPGP
RAPTYSVFRTVHTQGQWAYREGYPLPYEPPATDGSPGPAPAPTPGPGAGRRDSWIERGSR
SLPDSGRASPCPRDGEWFIKMLRAEVEKLEHWCQQMEREAEDYELPEEILEKIRSAVGST
QLLLSQKVQQFFRLCQQSMDPTAFPVPTFQDLAGFWDLLQLSIEDVTLKFLELQQLKANS
WKLLEPKEEKKVPPPIPKKPLRGRGVPVKERSLDSVDRQRQEARKRLLAAKRAASFRHSS
ATESADSIEIYIPEAQTRL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95886	1.000	1.000	0.000	979	1.000	1.000	O95886.pdb.gz	DLGP3_HUMAN Disks large-associated protein 3 OS=Homo sapiens OX=9606 GN=DLGAP3 PE=1 SV=3
2	AFDB:Q9P1A6	0.234	0.220	2.310E-58	1054	0.485	0.451	Q9P1A6.pdb.gz	DLGP2_HUMAN Disks large-associated protein 2 OS=Homo sapiens OX=9606 GN=DLGAP2 PE=1 SV=4
3	AFDB:B1AZP2	0.178	0.176	5.514E-39	992	0.391	0.386	B1AZP2.pdb.gz	DLGP4_MOUSE Disks large-associated protein 4 OS=Mus musculus OX=10090 GN=Dlgap4 PE=1 SV=1
4	PDB:4r0yB	0.110	0.225	1.613E-10	473	0.068	0.142	4r0yB.pdb.gz
5	AFDB:P0CY24	0.044	0.039	6.838E-5	1228	0.139	0.111	P0CY24.pdb.gz	STE20_CANAL Serine/threonine-protein kinase CST20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CST20 PE=3 SV=1
6	AFDB:Q6ZRI6	0.063	0.061	1.404E-4	1047	0.171	0.160	Q6ZRI6.pdb.gz	CO039_HUMAN Uncharacterized protein C15orf39 OS=Homo sapiens OX=9606 GN=C15orf39 PE=1 SV=3
7	AFDB:A0A0P0X9Z7	0.059	0.042	9.013E-4	1600	0.147	0.090	A0A0P0X9Z7.pdb.gz	CWZF7_ORYSJ Cysteine-tryptophan domain-containing zinc finger protein 7 OS=Oryza sativa subsp. japonica OX=39947 GN=CWZF7 PE=1 SV=2
8	AFDB:P39769	0.049	0.034	1.216E-3	1589	0.134	0.082	P39769.pdb.gz	PHP_DROME Polyhomeotic-proximal chromatin protein OS=Drosophila melanogaster OX=7227 GN=ph-p PE=1 SV=2
9	AFDB:Q5JV73	0.059	0.034	3.176E-3	1810	0.162	0.088	Q5JV73.pdb.gz	FRPD3_HUMAN FERM and PDZ domain-containing protein 3 OS=Homo sapiens OX=9606 GN=FRMPD3 PE=2 SV=2
10	AFDB:Q9HC77	0.054	0.043	4.286E-3	1338	0.148	0.108	Q9HC77.pdb.gz	CENPJ_HUMAN Centromere protein J OS=Homo sapiens OX=9606 GN=CENPJ PE=1 SV=2
11	AFDB:O88573	0.054	0.046	5.131E-3	1216	0.173	0.139	O88573.pdb.gz	AFF1_MOUSE AF4/FMR2 family member 1 OS=Mus musculus OX=10090 GN=Aff1 PE=1 SV=2
12	PDB:7nsuD	0.068	0.143	2.107E-1	420	0.015	0.036	7nsuD.pdb.gz
13	PDB:2b5uA	0.068	0.132	2.237E-1	470	0.015	0.032	2b5uA.pdb.gz
14	PDB:1y8pA	0.063	0.128	4.326E-1	381	0.023	0.060	1y8pA.pdb.gz	Crystal structure of pyruvate dehydrogenase kinase 3 bound to lipoyl domain 2 of human pyruvate dehydrogenase complex.
15	PDB:6ybwz	0.044	0.146	4.594E-1	160	0.031	0.188	6ybwz.pdb.gz	Structure of a human 48Stranslational initiation complex.
16	PDB:7naod	0.096	0.343	6.200E-1	217	0.023	0.106	7naod.pdb.gz
17	PDB:6elzb	0.076	0.150	6.990E-1	421	0.014	0.033	6elzb.pdb.gz	Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.
18	PDB:4h63H	0.059	0.289	8.885E-1	174	0.020	0.115	4h63H.pdb.gz
19	PDB:5mx5L	0.091	0.329	8.885E-1	214	0.012	0.056	5mx5L.pdb.gz
20	PDB:6xz6A	0.049	0.176	8.885E-1	213	0.016	0.075	6xz6A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14490	0.0	590	977	0.420	0.421	DLGP1_HUMAN Disks large-associated protein 1 OS=Homo sapiens OX=9606 GN=DLGAP1 PE=1 SV=1
2	O95886	0.0	1984	979	1.000	1.000	DLGP3_HUMAN Disks large-associated protein 3 OS=Homo sapiens OX=9606 GN=DLGAP3 PE=1 SV=3
3	P97836	0.0	565	992	0.415	0.409	DLGP1_RAT Disks large-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Dlgap1 PE=1 SV=1
4	P97837	0.0	723	1059	0.498	0.461	DLGP2_RAT Disks large-associated protein 2 OS=Rattus norvegicus OX=10116 GN=Dlgap2 PE=1 SV=3
5	P97838	0.0	1633	977	0.941	0.943	DLGP3_RAT Disks large-associated protein 3 OS=Rattus norvegicus OX=10116 GN=Dlgap3 PE=1 SV=2
6	Q6PFD5	0.0	1677	977	0.952	0.954	DLGP3_MOUSE Disks large-associated protein 3 OS=Mus musculus OX=10090 GN=Dlgap3 PE=1 SV=1
7	Q8BJ42	0.0	720	1059	0.494	0.457	DLGP2_MOUSE Disks large-associated protein 2 OS=Mus musculus OX=10090 GN=Dlgap2 PE=1 SV=2
8	Q9D415	0.0	567	992	0.415	0.409	DLGP1_MOUSE Disks large-associated protein 1 OS=Mus musculus OX=10090 GN=Dlgap1 PE=1 SV=3
9	Q9P1A6	0.0	728	1054	0.496	0.461	DLGP2_HUMAN Disks large-associated protein 2 OS=Homo sapiens OX=9606 GN=DLGAP2 PE=1 SV=4
10	Q9Y2H0	6.21e-137	437	992	0.393	0.388	DLGP4_HUMAN Disks large-associated protein 4 OS=Homo sapiens OX=9606 GN=DLGAP4 PE=1 SV=3
11	B1AZP2	2.80e-132	425	992	0.397	0.392	DLGP4_MOUSE Disks large-associated protein 4 OS=Mus musculus OX=10090 GN=Dlgap4 PE=1 SV=1
12	P97839	1.15e-130	421	992	0.395	0.390	DLGP4_RAT Disks large-associated protein 4 OS=Rattus norvegicus OX=10116 GN=Dlgap4 PE=1 SV=1
13	Q6IS01	2.60e-99	324	543	0.219	0.394	Q6IS01_HUMAN DLG associated protein 1 OS=Homo sapiens OX=9606 GN=DLGAP1 PE=1 SV=1
14	Q15398	2.29e-13	77.0	846	0.055	0.064	DLGP5_HUMAN Disks large-associated protein 5 OS=Homo sapiens OX=9606 GN=DLGAP5 PE=1 SV=2
15	Q7K3L1	1.52e-05	51.6	921	0.038	0.040	MARS_DROME Guanylate kinase-associated protein mars OS=Drosophila melanogaster OX=7227 GN=mars PE=1 SV=1
16	Q8N5C8	2.1	34.7	712	0.047	0.065	TAB3_HUMAN TGF-beta-activated kinase 1 and MAP3K7-binding protein 3 OS=Homo sapiens OX=9606 GN=TAB3 PE=1 SV=3
17	Q8IZD4	8.4	32.7	617	0.021	0.034	DCP1B_HUMAN mRNA-decapping enzyme 1B OS=Homo sapiens OX=9606 GN=DCP1B PE=1 SV=2
18	Q15113	9.9	32.3	449	0.026	0.056	PCOC1_HUMAN Procollagen C-endopeptidase enhancer 1 OS=Homo sapiens OX=9606 GN=PCOLCE PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03359 GKAP	7.7e-157	533.8	Guanylate-kinase-associated protein (GKAP) protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362444

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000382428	0.984	Disks large homolog 4
2	9606.ENSP00000293441	0.975	SH3 and multiple ankyrin repeat domains protein 1
3	9606.ENSP00000469689	0.939	SH3 and multiple ankyrin repeat domains protein 2
4	9606.ENSP00000365272	0.871	Disks large homolog 2
5	9606.ENSP00000363480	0.842	Disks large homolog 3
6	9606.ENSP00000306138	0.834	Metabotropic glutamate receptor 5
7	9606.ENSP00000366283	0.828	SLIT and NTRK-like protein 5
8	9606.ENSP00000380638	0.819	Protein-tyrosine kinase 2-beta
9	9606.ENSP00000334382	0.806	Homer protein homolog 1
10	9606.ENSP00000351591	0.789	Neuroligin-3
11	9606.ENSP00000400258	0.774	Disks large-associated protein 2
12	9606.ENSP00000265459	0.766	Neurexin-2
13	9606.ENSP00000370485	0.763	Neuroligin-4, X-linked
14	9606.ENSP00000385142	0.761	Neurexin-1
15	9606.ENSP00000328677	0.753	C2 calcium-dependent domain-containing protein 4C
16	9606.ENSP00000403636	0.735	Ras/Rap GTPase-activating protein SynGAP
17	9606.ENSP00000293662	0.730	General receptor for phosphoinositides 1-associated scaffold protein
18	9606.ENSP00000439937	0.730	Homer protein homolog 3
19	9606.ENSP00000305288	0.724	Neuroligin-2
20	9606.ENSP00000323516	0.720	Urotensin-2 receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050794	0.959	regulation of cellular process
GO:0016043	0.945	cellular component organization
GO:0044085	0.755	cellular component biogenesis
GO:0043933	0.679	protein-containing complex organization
GO:0010646	0.632	regulation of cell communication
GO:0023051	0.585	regulation of signaling
GO:0022607	0.427	cellular component assembly
GO:0023052	0.405	signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043226	0.988	organelle
GO:0045202	0.985	synapse
GO:0005622	0.942	intracellular anatomical structure
GO:0098794	0.771	postsynapse
GO:0005737	0.714	cytoplasm
GO:0043229	0.706	intracellular organelle
GO:0043227	0.619	membrane-bounded organelle
GO:0043231	0.541	intracellular membrane-bounded organelle
GO:0005829	0.443	cytosol
GO:0120025	0.393	plasma membrane bounded cell projection
GO:0036477	0.347	somatodendritic compartment
GO:0043005	0.330	neuron projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]