StarFunc result for job id O95925

User Input

>input (133 residues)
MGSSGLLSLLVLFVLLANVQGPGLTDWLFPRRCPKIREECEFQERDVCTKDRQCQDNKKC
CVFSCGKKCLDLKQDVCEMPKETGPCLAYFLHWWYDKKDNTCSMFVYGGCQGNNNNFQSK
ANCLNTCKNKRFP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95925	1.000	1.000	1.118E-28	133	1.000	1.000	O95925.pdb.gz	EPPI_HUMAN Eppin OS=Homo sapiens OX=9606 GN=EPPIN PE=1 SV=1
2	AFDB:Q9DA01	0.835	0.830	6.694E-19	134	0.617	0.612	Q9DA01.pdb.gz	EPPI_MOUSE Eppin OS=Mus musculus OX=10090 GN=Eppin PE=1 SV=1
3	AFDB:Q9BQY6	0.360	0.365	1.117E-7	131	0.421	0.427	Q9BQY6.pdb.gz	WFDC6_HUMAN WAP four-disulfide core domain protein 6 OS=Homo sapiens OX=9606 GN=WFDC6 PE=1 SV=1
4	AFDB:Q6P796	0.405	0.281	4.121E-7	193	0.256	0.176	Q6P796.pdb.gz	Q6P796_RAT Serine peptidase inhibitor, Kunitz type, 2 OS=Rattus norvegicus OX=10116 GN=Spint2 PE=1 SV=1
5	AFDB:P86733	0.401	0.422	6.096E-7	126	0.188	0.198	P86733.pdb.gz	KCP_HALAI BPTI/Kunitz domain-containing protein (Fragment) OS=Haliotis asinina OX=109174 PE=1 SV=1
6	AFDB:P00974	0.394	0.521	9.018E-7	100	0.241	0.320	P00974.pdb.gz	BPT1_BOVIN Pancreatic trypsin inhibitor OS=Bos taurus OX=9913 PE=1 SV=2
7	AFDB:P84875	0.398	0.322	9.018E-7	165	0.203	0.164	P84875.pdb.gz	PCPI_SABMA Carboxypeptidase inhibitor SmCI OS=Sabellastarte magnifica OX=389514 PE=1 SV=1
8	AFDB:P0DJ50	0.399	0.652	1.097E-6	81	0.188	0.309	P0DJ50.pdb.gz	VKT31_MESMA Kunitz-type serine protease inhibitor BmKTT-2 OS=Mesobuthus martensii OX=34649 PE=2 SV=2
9	AFDB:O43291	0.420	0.227	1.250E-6	252	0.188	0.099	O43291.pdb.gz	SPIT2_HUMAN Kunitz-type protease inhibitor 2 OS=Homo sapiens OX=9606 GN=SPINT2 PE=1 SV=2
10	PDB:4bd9B	0.396	0.321	1.839E-6	165	0.203	0.164	4bd9B.pdb.gz	A Noncanonical Mechanism of Carboxypeptidase Inhibition Revealed by the Crystal Structure of the Tri-Kunitz Smci in Complex with Human Cpa4.
11	AFDB:B2G331	0.396	0.673	2.106E-6	78	0.173	0.295	B2G331.pdb.gz	VKT2B_HETCR TauPI-stichotoxin-Hcr2b OS=Heteractis crispa OX=175771 PE=1 SV=1
12	PDB:3bybA	0.397	0.895	3.770E-6	58	0.188	0.431	3bybA.pdb.gz
13	PDB:2m01A	0.381	0.777	9.055E-4	59	0.143	0.322	2m01A.pdb.gz
14	PDB:1e4wL	0.112	0.078	2.278	214	0.045	0.028	1e4wL.pdb.gz	Cross-Reactive Binding of Cyclic Peptides to an Anti-Tgf Alpha Antibody Fab Fragment: An X-Ray Structural and Thermodynamic Analysis
15	PDB:3u0wL	0.111	0.077	2.958	213	0.045	0.028	3u0wL.pdb.gz
16	PDB:5xf8C	0.123	0.046	3.598	469	0.060	0.017	5xf8C.pdb.gz
17	PDB:1mf2L	0.115	0.080	4.099	215	0.030	0.019	1mf2L.pdb.gz
18	PDB:3ce6A	0.141	0.047	4.376	486	0.030	0.008	3ce6A.pdb.gz	Crystal structures of Mycobacterium tuberculosis S-adenosyl-L-homocysteine hydrolase in ternary complex with substrate and inhibitors.
19	PDB:1knoE	0.115	0.080	4.671	214	0.045	0.028	1knoE.pdb.gz	Crystal structure of the complex of a catalytic antibody Fab fragment with a transition state analog: structural similarities in esterase-like catalytic antibodies.
20	PDB:7p2pB	0.152	0.123	4.671	179	0.135	0.101	7p2pB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95925	4.89e-96	274	133	1.000	1.000	EPPI_HUMAN Eppin OS=Homo sapiens OX=9606 GN=EPPIN PE=1 SV=1
2	Q9DA01	1.47e-60	184	134	0.617	0.612	EPPI_MOUSE Eppin OS=Mus musculus OX=10090 GN=Eppin PE=1 SV=1
3	Q9BQY6	6.29e-37	124	131	0.474	0.481	WFDC6_HUMAN WAP four-disulfide core domain protein 6 OS=Homo sapiens OX=9606 GN=WFDC6 PE=1 SV=1
4	Q45WF5	3.29e-14	65.1	78	0.218	0.372	Q45WF5_DROME ACP24A4 OS=Drosophila melanogaster OX=7227 GN=Acp24A4 PE=4 SV=1
5	Q45WF6	4.00e-14	64.7	78	0.218	0.372	Q45WF6_DROME ACP24A4 OS=Drosophila melanogaster OX=7227 GN=Acp24A4 PE=4 SV=1
6	Q4V621	4.75e-14	64.7	78	0.218	0.372	Q4V621_DROME ACP24A4 OS=Drosophila melanogaster OX=7227 GN=Acp24A4 PE=2 SV=1
7	P86733	9.84e-14	65.1	126	0.188	0.198	KCP_HALAI BPTI/Kunitz domain-containing protein (Fragment) OS=Haliotis asinina OX=109174 PE=1 SV=1
8	P0DJ50	2.18e-13	63.2	81	0.188	0.309	VKT31_MESMA Kunitz-type serine protease inhibitor BmKTT-2 OS=Mesobuthus martensii OX=34649 PE=2 SV=2
9	B2G331	2.56e-13	62.8	78	0.173	0.295	VKT2B_HETCR TauPI-stichotoxin-Hcr2b OS=Heteractis crispa OX=175771 PE=1 SV=1
10	P84875	7.22e-13	63.9	165	0.203	0.164	PCPI_SABMA Carboxypeptidase inhibitor SmCI OS=Sabellastarte magnifica OX=389514 PE=1 SV=1
11	Q90WA1	7.34e-13	61.6	83	0.188	0.301	VKT1_PSETT Kunitz-type serine protease inhibitor textilinin-1 OS=Pseudonaja textilis textilis OX=169397 PE=1 SV=1
12	P12111	8.67e-13	66.2	3177	0.173	0.007	CO6A3_HUMAN Collagen alpha-3(VI) chain OS=Homo sapiens OX=9606 GN=COL6A3 PE=1 SV=5
13	Q868Z9	1.34e-12	65.5	2898	0.195	0.009	PPN_DROME Papilin OS=Drosophila melanogaster OX=7227 GN=Ppn PE=1 SV=2
14	Q45WF1	1.44e-12	60.8	78	0.211	0.359	Q45WF1_DROME ACP24A4 OS=Drosophila melanogaster OX=7227 GN=Acp24A4 PE=4 SV=1
15	Q6NUZ1	2.29e-12	64.7	738	0.180	0.033	Q6NUZ1_DANRE Amyloid-beta A4 protein OS=Danio rerio OX=7955 GN=wu:fj08a12 PE=2 SV=1
16	Q6P796	2.95e-12	62.8	193	0.188	0.130	Q6P796_RAT Serine peptidase inhibitor, Kunitz type, 2 OS=Rattus norvegicus OX=10116 GN=Spint2 PE=1 SV=1
17	A9JR82	5.08e-12	63.9	499	0.241	0.064	A9JR82_DANRE Serine peptidase inhibitor, Kunitz type 1 b precursor OS=Danio rerio OX=7955 GN=spint1b PE=1 SV=1
18	Q9WU03	5.28e-12	62.8	252	0.211	0.111	SPIT2_MOUSE Kunitz-type protease inhibitor 2 OS=Mus musculus OX=10090 GN=Spint2 PE=1 SV=1
19	A0A8I6ADR1	5.32e-12	63.9	2708	0.180	0.009	A0A8I6ADR1_RAT Collagen type VI alpha 3 chain OS=Rattus norvegicus OX=10116 GN=Col6a3 PE=1 SV=1
20	A0A8I5ZTR6	5.34e-12	63.9	3109	0.180	0.008	A0A8I5ZTR6_RAT Collagen type VI alpha 3 chain OS=Rattus norvegicus OX=10116 GN=Col6a3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00014 Kunitz_BPTI	1.6e-15	68.4	Kunitz/Bovine pancreatic trypsin inhibitor domain
2	PF00095 WAP	0.00029	32.5	WAP-type (Whey Acidic Protein) 'four-disulfide core'

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361746

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361867	0.879	Semenogelin-1
2	9606.ENSP00000231751	0.840	Lactotransferrin
3	9606.ENSP00000321835	0.720	ETS translocation variant 4
4	9606.ENSP00000382770	0.648	Potassium channel subfamily U member 1
5	9606.ENSP00000315130	0.566	Clusterin
6	9606.ENSP00000361726	0.566	WAP four-disulfide core domain containing
7	9606.ENSP00000371835	0.559	Beta-defensin 126
8	9606.ENSP00000365858	0.539	Erythroid transcription factor
9	9606.ENSP00000314151	0.535	Prostate-specific antigen
10	9606.ENSP00000279058	0.504	Serine peptidase inhibitor, Kunitz type 4
11	9606.ENSP00000320532	0.501	Protein WFDC9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0098772	0.967	molecular function regulator activity
GO:0030234	0.949	enzyme regulator activity
GO:0140678	0.926	molecular function inhibitor activity
GO:0061134	0.919	peptidase regulator activity
GO:0030414	0.890	peptidase inhibitor activity
GO:0004866	0.777	endopeptidase inhibitor activity
GO:0004867	0.735	serine-type endopeptidase inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.980	response to stimulus
GO:0050789	0.976	regulation of biological process
GO:0050794	0.962	regulation of cellular process
GO:0044419	0.867	biological process involved in interspecies interaction between organisms
GO:2000145	0.867	regulation of cell motility
GO:0048519	0.862	negative regulation of biological process
GO:0009605	0.844	response to external stimulus
GO:0003352	0.725	regulation of cilium movement
GO:1902019	0.724	regulation of cilium-dependent cell motility
GO:0060295	0.609	regulation of cilium movement involved in cell motility
GO:0009987	0.594	cellular process
GO:0009607	0.590	response to biotic stimulus
GO:0006950	0.506	response to stress
GO:0019222	0.499	regulation of metabolic process
GO:0060255	0.494	regulation of macromolecule metabolic process
GO:0080090	0.481	regulation of primary metabolic process
GO:0051171	0.481	regulation of nitrogen compound metabolic process
GO:0051707	0.465	response to other organism
GO:0042742	0.435	defense response to bacterium
GO:0065009	0.402	regulation of molecular function
GO:0048523	0.388	negative regulation of cellular process
GO:0051246	0.347	regulation of protein metabolic process
GO:0048518	0.320	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.997	extracellular region
GO:0005886	0.987	plasma membrane
GO:0032991	0.986	protein-containing complex
GO:0043226	0.899	organelle
GO:0005622	0.896	intracellular anatomical structure
GO:0005615	0.881	extracellular space
GO:0043231	0.845	intracellular membrane-bounded organelle
GO:0097524	0.797	sperm plasma membrane
GO:0009986	0.731	cell surface
GO:0031982	0.581	vesicle
GO:0005737	0.481	cytoplasm
GO:0005634	0.392	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]