StarFunc result for job id O95935

User Input

>input (607 residues)
MAEKRRGSPCSMLSLKAHAFSVEALIGAEKQQQLQKKRRKLGAEEAAGAVDDGGCSRGGG
AGEKGSSEGDEGAALPPPAGATSGPARSGADLERGAAGGCEDGFQQGASPLASPGGSPKG
SPARSLARPGTPLPSPQAPRVDLQGAELWKRFHEIGTEMIITKAGRRMFPAMRVKISGLD
PHQQYYIAMDIVPVDNKRYRYVYHSSKWMVAGNADSPVPPRVYIHPDSPASGETWMRQVI
SFDKLKLTNNELDDQGHIILHSMHKYQPRVHVIRKDCGDDLSPIKPVPSGEGVKAFSFPE
TVFTTVTAYQNQQITRLKIDRNPFAKGFRDSGRNRMGLEALVESYAFWRPSLRTLTFEDI
PGIPKQGNASSSTLLQGTGNGVPATHPHLLSGSSCSSPAFHLGPNTSQLCSLAPADYSAC
ARSGLTLNRYSTSLAETYNRLTNQAGETFAPPRTPSYVGVSSSTSVNMSMGGTDGDTFSC
PQTSLSMQISGMSPQLQYIMPSPSSNAFATNQTHQGSYNTFRLHSPCALYGYNFSTSPKL
AASPEKIVSSQGSFLGSSPSGTMTDRQMLPPVEGVHLLSSGGQQSFFDSRTLGSLTLSSS
QVSAHMV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9EPZ6	0.526	0.522	3.616E-89	613	0.944	0.935	Q9EPZ6.pdb.gz	TBX18_MOUSE T-box transcription factor TBX18 OS=Mus musculus OX=10090 GN=Tbx18 PE=1 SV=1
2	AFDB:O62535	0.301	0.257	1.402E-36	712	0.295	0.251	O62535.pdb.gz	O62535_DROME Optomotor-blind-related gene-1 protein OS=Drosophila melanogaster OX=7227 GN=org-1 PE=2 SV=1
3	AFDB:Q9UMR3	0.319	0.426	6.285E-36	447	0.313	0.425	Q9UMR3.pdb.gz	TBX20_HUMAN T-box transcription factor TBX20 OS=Homo sapiens OX=9606 GN=TBX20 PE=1 SV=4
4	AFDB:Q9I9K7	0.324	0.434	8.484E-36	446	0.290	0.395	Q9I9K7.pdb.gz	TBX20_DANRE T-box transcription factor TBX20 OS=Danio rerio OX=7955 GN=tbx20 PE=2 SV=1
5	AFDB:Q8AX98	0.302	0.395	1.263E-34	463	0.259	0.339	Q8AX98.pdb.gz	TBX1A_XENLA T-box transcription factor TBX1-A OS=Xenopus laevis OX=8355 GN=tbx1-a PE=1 SV=1
6	AFDB:O75333	0.301	0.467	8.112E-34	385	0.245	0.387	O75333.pdb.gz	TBX10_HUMAN T-box transcription factor TBX10 OS=Homo sapiens OX=9606 GN=TBX10 PE=2 SV=2
7	AFDB:O95947	0.301	0.418	6.240E-33	436	0.255	0.356	O95947.pdb.gz	TBX6_HUMAN T-box transcription factor TBX6 OS=Homo sapiens OX=9606 GN=TBX6 PE=1 SV=2
8	AFDB:P70326	0.319	0.370	2.336E-32	518	0.275	0.322	P70326.pdb.gz	TBX5_MOUSE T-box transcription factor TBX5 OS=Mus musculus OX=10090 GN=Tbx5 PE=1 SV=2
9	AFDB:Q8JIS6	0.307	0.215	2.151E-31	874	0.278	0.193	Q8JIS6.pdb.gz	TBX6_DANRE T-box transcription factor TBX6 OS=Danio rerio OX=7955 GN=tbx6 PE=2 SV=2
10	AFDB:P90971	0.325	0.553	2.234E-30	346	0.211	0.370	P90971.pdb.gz	TBX12_CAEEL T-box protein 12 OS=Caenorhabditis elegans OX=6239 GN=mab-9 PE=1 SV=2
11	PDB:3fxiC	0.098	0.274	2.926E-2	140	0.036	0.157	3fxiC.pdb.gz
12	PDB:7b0xC	0.093	0.207	2.926E-2	211	0.030	0.085	7b0xC.pdb.gz
13	PDB:7q1yA	0.103	0.052	3.107E-2	1374	0.016	0.007	7q1yA.pdb.gz
14	PDB:1f13A	0.086	0.075	4.454E-2	722	0.021	0.018	1f13A.pdb.gz
15	PDB:2iqyA	0.097	0.234	4.454E-2	190	0.028	0.089	2iqyA.pdb.gz
16	PDB:7tysA	0.074	0.106	5.332E-2	361	0.036	0.061	7tysA.pdb.gz	Ligand-mediated Structural Dynamics of a Mammalian Pancreatic K ATP Channel.
17	PDB:6xt9I	0.082	0.068	8.617E-2	767	0.021	0.017	6xt9I.pdb.gz
18	PDB:5iv5BJ	0.074	0.049	1.095E-1	1004	0.023	0.014	5iv5BJ.pdb.gz	Structure of the T4 baseplate and its function in triggering sheath contraction.
19	PDB:5tv1A	0.091	0.148	1.095E-1	337	0.035	0.062	5tv1A.pdb.gz	Structural basis of arrestin-3 activation and signaling.
20	PDB:3hlkB	0.104	0.143	1.235E-1	411	0.036	0.054	3hlkB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O70306	0.0	575	602	0.565	0.570	TBX15_MOUSE T-box transcription factor TBX15 OS=Mus musculus OX=10090 GN=Tbx15 PE=1 SV=2
2	O95935	0.0	1250	607	1.000	1.000	TBX18_HUMAN T-box transcription factor TBX18 OS=Homo sapiens OX=9606 GN=TBX18 PE=1 SV=3
3	Q8JFF9	0.0	674	554	0.636	0.697	Q8JFF9_DANRE T-box containing transcription factor OS=Danio rerio OX=7955 GN=tbx18 PE=2 SV=1
4	Q96SF7	0.0	576	602	0.568	0.573	TBX15_HUMAN T-box transcription factor TBX15 OS=Homo sapiens OX=9606 GN=TBX15 PE=1 SV=2
5	Q9EPZ6	0.0	1132	613	0.939	0.930	TBX18_MOUSE T-box transcription factor TBX18 OS=Mus musculus OX=10090 GN=Tbx18 PE=1 SV=1
6	Q9Y458	5.36e-111	344	520	0.333	0.388	TBX22_HUMAN T-box transcription factor TBX22 OS=Homo sapiens OX=9606 GN=TBX22 PE=1 SV=3
7	Q8UW76	3.17e-94	298	440	0.244	0.336	TBX20_CHICK T-box transcription factor TBX20 OS=Gallus gallus OX=9031 GN=TBX20 PE=2 SV=1
8	Q9ES03	5.23e-94	298	445	0.236	0.321	TBX20_MOUSE T-box transcription factor TBX20 OS=Mus musculus OX=10090 GN=Tbx20 PE=2 SV=3
9	Q9UMR3	8.01e-92	292	447	0.226	0.306	TBX20_HUMAN T-box transcription factor TBX20 OS=Homo sapiens OX=9606 GN=TBX20 PE=1 SV=4
10	Q9I9K7	7.45e-91	290	446	0.226	0.307	TBX20_DANRE T-box transcription factor TBX20 OS=Danio rerio OX=7955 GN=tbx20 PE=2 SV=1
11	Q8AXW8	1.24e-88	283	441	0.221	0.304	TBX20_XENLA T-box transcription factor TBX20 OS=Xenopus laevis OX=8355 GN=tbx20 PE=2 SV=1
12	P90971	4.28e-77	250	346	0.219	0.384	TBX12_CAEEL T-box protein 12 OS=Caenorhabditis elegans OX=6239 GN=mab-9 PE=1 SV=2
13	O43435	3.09e-76	249	398	0.189	0.289	TBX1_HUMAN T-box transcription factor TBX1 OS=Homo sapiens OX=9606 GN=TBX1 PE=1 SV=1
14	Q8AX98	1.70e-75	250	463	0.191	0.251	TBX1A_XENLA T-box transcription factor TBX1-A OS=Xenopus laevis OX=8355 GN=tbx1-a PE=1 SV=1
15	Q8AXX2	2.39e-75	249	460	0.189	0.250	TBX1_DANRE T-box transcription factor TBX1 OS=Danio rerio OX=7955 GN=tbx1 PE=2 SV=1
16	O75333	3.15e-75	246	385	0.193	0.304	TBX10_HUMAN T-box transcription factor TBX10 OS=Homo sapiens OX=9606 GN=TBX10 PE=2 SV=2
17	Q9W3F4	3.82e-75	255	699	0.193	0.167	Q9W3F4_DROME Optomotor-blind-related-gene-1, isoform A OS=Drosophila melanogaster OX=7227 GN=org-1 PE=4 SV=1
18	O62535	4.20e-75	255	712	0.193	0.164	O62535_DROME Optomotor-blind-related gene-1 protein OS=Drosophila melanogaster OX=7227 GN=org-1 PE=2 SV=1
19	Q9VMR2	4.29e-75	252	580	0.219	0.229	Q9VMR2_DROME LP04777p OS=Drosophila melanogaster OX=7227 GN=mid PE=2 SV=1
20	Q8SYY8	1.02e-74	251	571	0.216	0.229	Q8SYY8_DROME RE27439p OS=Drosophila melanogaster OX=7227 GN=mid PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00907 T-box	4.3e-74	260.0	T-box

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358677

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356857	0.891	Transcription factor 21
2	9606.ENSP00000327758	0.856	Homeobox protein Nkx-2.5
3	9606.ENSP00000331327	0.854	Wilms tumor protein
4	9606.ENSP00000247182	0.835	Homeobox protein SIX1
5	9606.ENSP00000249750	0.815	Retinal dehydrogenase 2
6	9606.ENSP00000334458	0.810	Transcription factor GATA-4
7	9606.ENSP00000374240	0.806	Short stature homeobox protein 2
8	9606.ENSP00000482393	0.804	Iroquois-class homeodomain protein IRX-4
9	9606.ENSP00000452871	0.743	Transducin-like enhancer protein 3
10	9606.ENSP00000261917	0.742	Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4
11	9606.ENSP00000230658	0.732	Insulin gene enhancer protein ISL-1
12	9606.ENSP00000284136	0.721	Semaphorin-3D
13	9606.ENSP00000241125	0.653	Gap junction alpha-3 protein
14	9606.ENSP00000484552	0.643	Gap junction alpha-5 protein
15	9606.ENSP00000223364	0.642	Myosin regulatory light chain 2, atrial isoform
16	9606.ENSP00000321684	0.638	Homeobox protein MOX-1
17	9606.ENSP00000352565	0.637	Heart- and neural crest derivatives-expressed protein 2
18	9606.ENSP00000314480	0.635	Homeobox protein unc-4 homolog
19	9606.ENSP00000357342	0.615	Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3
20	9606.ENSP00000365663	0.609	Natriuretic peptides A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000976	0.999	transcription cis-regulatory region binding
GO:0000981	0.997	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.994	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.820	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0140297	0.787	DNA-binding transcription factor binding
GO:0042802	0.776	identical protein binding
GO:0061629	0.759	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0001227	0.758	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0046983	0.729	protein dimerization activity
GO:0042803	0.706	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048856	0.997	anatomical structure development
GO:0032501	0.996	multicellular organismal process
GO:0007275	0.993	multicellular organism development
GO:0009987	0.989	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0048513	0.976	animal organ development
GO:0048731	0.968	system development
GO:0060255	0.966	regulation of macromolecule metabolic process
GO:0010468	0.938	regulation of gene expression
GO:0072359	0.936	circulatory system development
GO:0048869	0.915	cellular developmental process
GO:0080090	0.913	regulation of primary metabolic process
GO:0031323	0.913	regulation of cellular metabolic process
GO:0051171	0.912	regulation of nitrogen compound metabolic process
GO:0030154	0.900	cell differentiation
GO:0009888	0.899	tissue development
GO:0061061	0.896	muscle structure development
GO:0031326	0.895	regulation of cellular biosynthetic process
GO:0051252	0.895	regulation of RNA metabolic process
GO:0007507	0.888	heart development
GO:0006355	0.875	regulation of DNA-templated transcription
GO:0009653	0.860	anatomical structure morphogenesis
GO:0048518	0.803	positive regulation of biological process
GO:0006357	0.758	regulation of transcription by RNA polymerase II
GO:0048522	0.719	positive regulation of cellular process
GO:0035295	0.712	tube development
GO:0009893	0.613	positive regulation of metabolic process
GO:0010604	0.600	positive regulation of macromolecule metabolic process
GO:0050896	0.569	response to stimulus
GO:0051173	0.487	positive regulation of nitrogen compound metabolic process
GO:0031325	0.487	positive regulation of cellular metabolic process
GO:0048519	0.485	negative regulation of biological process
GO:0048523	0.467	negative regulation of cellular process
GO:0009892	0.436	negative regulation of metabolic process
GO:0009887	0.379	animal organ morphogenesis
GO:0045892	0.377	negative regulation of DNA-templated transcription
GO:0009891	0.348	positive regulation of biosynthetic process
GO:1902680	0.335	positive regulation of RNA biosynthetic process
GO:0042127	0.334	regulation of cell population proliferation
GO:0045893	0.328	positive regulation of DNA-templated transcription
GO:0051239	0.305	regulation of multicellular organismal process
GO:0009790	0.302	embryo development
GO:0045944	0.300	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0032991	0.892	protein-containing complex
GO:0005737	0.534	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]