StarFunc result for job id O95936

User Input

>input (686 residues)
MQLGEQLLVSSVNLPGAHFYPLESARGGSGGSAGHLPSAAPSPQKLDLDKASKKFSGSLS
CEAVSGEPAAASAGAPAAMLSDTDAGDAFASAAAVAKPGPPDGRKGSPCGEEELPSAAAA
AAAAAAAAAATARYSMDSLSSERYYLQSPGPQGSELAAPCSLFPYQAAAGAPHGPVYPAP
NGARYPYGSMLPPGGFPAAVCPPGRAQFGPGAGAGSGAGGSSGGGGGPGTYQYSQGAPLY
GPYPGAAAAGSCGGLGGLGVPGSGFRAHVYLCNRPLWLKFHRHQTEMIITKQGRRMFPFL
SFNINGLNPTAHYNVFVEVVLADPNHWRFQGGKWVTCGKADNNMQGNKMYVHPESPNTGS
HWMRQEISFGKLKLTNNKGANNNNTQMIVLQSLHKYQPRLHIVEVTEDGVEDLNEPSKTQ
TFTFSETQFIAVTAYQNTDITQLKIDHNPFAKGFRDNYDSSHQIVPGGRYGVQSFFPEPF
VNTLPQARYYNGERTVPQTNGLLSPQQSEEVANPPQRWLVTPVQQPGTNKLDISSYESEY
TSSTLLPYGIKSLPLQTSHALGYYPDPTFPAMAGWGGRGSYQRKMAAGLPWTSRTSPTVF
SEDQLSKEKVKEEIGSSWIETPPSIKSLDSNDSGVYTSACKRRRLSPSNSSNENSPSIKC
EDINAEEYSKDTSKGMGGYYAFYTTP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95936	0.999	0.999	0.000	686	1.000	1.000	O95936.pdb.gz	EOMES_HUMAN Eomesodermin homolog OS=Homo sapiens OX=9606 GN=EOMES PE=1 SV=3
2	AFDB:Q16650	0.310	0.312	2.224E-50	682	0.464	0.466	Q16650.pdb.gz	TBR1_HUMAN T-box brain protein 1 OS=Homo sapiens OX=9606 GN=TBR1 PE=1 SV=1
3	AFDB:Q8AXX2	0.268	0.397	8.634E-30	460	0.194	0.289	Q8AXX2.pdb.gz	TBX1_DANRE T-box transcription factor TBX1 OS=Danio rerio OX=7955 GN=tbx1 PE=2 SV=1
4	AFDB:G1K2W9	0.276	0.434	5.710E-29	430	0.195	0.312	G1K2W9.pdb.gz
5	AFDB:Q9UMR3	0.276	0.420	1.609E-28	447	0.191	0.293	Q9UMR3.pdb.gz	TBX20_HUMAN T-box transcription factor TBX20 OS=Homo sapiens OX=9606 GN=TBX20 PE=1 SV=4
6	AFDB:F1NZI2	0.258	0.400	6.944E-28	433	0.188	0.298	F1NZI2.pdb.gz
7	AFDB:Q8JIS6	0.267	0.211	9.012E-22	874	0.190	0.149	Q8JIS6.pdb.gz	TBX6_DANRE T-box transcription factor TBX6 OS=Danio rerio OX=7955 GN=tbx6 PE=2 SV=2
8	AFDB:Q09376	0.266	0.535	4.732E-20	325	0.105	0.222	Q09376.pdb.gz	TBX35_CAEEL T-box transcription factor tbx-35 OS=Caenorhabditis elegans OX=6239 GN=tbx-35 PE=3 SV=2
9	AFDB:F1QXN5	0.089	0.047	6.664E-3	1416	0.160	0.078	F1QXN5.pdb.gz
10	PDB:7b0xC	0.091	0.223	5.670E-2	211	0.020	0.066	7b0xC.pdb.gz
11	AFDB:F1NY98	0.082	0.030	7.176E-2	2034	0.082	0.028	F1NY98.pdb.gz	DSCAM_CHICK Cell adhesion molecule DSCAM OS=Gallus gallus OX=9031 GN=DSCAM PE=1 SV=3
12	PDB:4lnvA	0.099	0.059	8.173E-2	1276	0.026	0.014	4lnvA.pdb.gz
13	PDB:4lnvB	0.105	0.072	1.698E-1	1063	0.023	0.015	4lnvB.pdb.gz
14	PDB:1ezvX	0.095	0.358	1.805E-1	127	0.019	0.102	1ezvX.pdb.gz	Structure at 2.3 A resolution of the cytochrome bc(1) complex from the yeast Saccharomyces cerevisiae co-crystallized with an antibody Fv fragment.
15	PDB:1fuxA	0.119	0.362	1.805E-1	165	0.026	0.109	1fuxA.pdb.gz
16	PDB:2qhrL	0.083	0.185	1.805E-1	218	0.019	0.060	2qhrL.pdb.gz	Complex of a protective antibody with its Ebola virus GP peptide epitope: unusual features of a V lambda x light chain.
17	PDB:7ea3J	0.087	0.071	1.805E-1	883	0.015	0.011	7ea3J.pdb.gz
18	PDB:1l9mB	0.110	0.110	1.918E-1	681	0.036	0.037	1l9mB.pdb.gz	Three-dimensional structure of the human transglutaminase 3 enzyme: binding of calcium ions changes structure for activation.
19	PDB:2iqyA	0.082	0.231	2.039E-1	190	0.029	0.105	2iqyA.pdb.gz
20	PDB:4f38B	0.091	0.250	2.039E-1	192	0.025	0.089	4f38B.pdb.gz	Quantitative Analysis of Prenylated RhoA Interaction with Its Chaperone, RhoGDI.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E8Z504	0.0	729	650	0.601	0.634	E8Z504_SALSA Eomesodermin OS=Salmo salar OX=8030 GN=Eomes PE=2 SV=1
2	O54839	0.0	1097	707	0.902	0.876	EOMES_MOUSE Eomesodermin homolog OS=Mus musculus OX=10090 GN=Eomes PE=1 SV=3
3	O95936	0.0	1408	686	1.000	1.000	EOMES_HUMAN Eomesodermin homolog OS=Homo sapiens OX=9606 GN=EOMES PE=1 SV=3
4	P79944	0.0	795	692	0.668	0.662	EOMES_XENLA Eomesodermin OS=Xenopus laevis OX=8355 GN=eomes PE=2 SV=1
5	Q98TU2	0.0	692	661	0.563	0.584	Q98TU2_DANRE Eomesa protein OS=Danio rerio OX=7955 GN=eomes PE=2 SV=1
6	Q64336	4.40e-168	499	681	0.459	0.463	TBR1_MOUSE T-box brain protein 1 OS=Mus musculus OX=10090 GN=Tbr1 PE=1 SV=2
7	D4A6N8	1.04e-167	498	681	0.459	0.463	D4A6N8_RAT T-box brain transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Tbr1 PE=1 SV=4
8	Q16650	1.12e-166	496	682	0.458	0.460	TBR1_HUMAN T-box brain protein 1 OS=Homo sapiens OX=9606 GN=TBR1 PE=1 SV=1
9	Q9JKD8	1.66e-105	333	530	0.327	0.423	TBX21_MOUSE T-box transcription factor TBX21 OS=Mus musculus OX=10090 GN=Tbx21 PE=1 SV=1
10	Q9UL17	5.55e-102	323	535	0.309	0.396	TBX21_HUMAN T-box transcription factor TBX21 OS=Homo sapiens OX=9606 GN=TBX21 PE=1 SV=1
11	Q99593	2.60e-55	199	518	0.150	0.199	TBX5_HUMAN T-box transcription factor TBX5 OS=Homo sapiens OX=9606 GN=TBX5 PE=1 SV=2
12	O93288	2.89e-55	199	541	0.160	0.203	O93288_CHICK T-Box protein 4 OS=Gallus gallus OX=9031 GN=TBX4 PE=1 SV=1
13	P70326	3.45e-55	199	518	0.150	0.199	TBX5_MOUSE T-box transcription factor TBX5 OS=Mus musculus OX=10090 GN=Tbx5 PE=1 SV=2
14	Q9IAK8	4.10e-55	198	492	0.150	0.209	TBX5A_DANRE T-box transcription factor TBX5-A OS=Danio rerio OX=7955 GN=tbx5a PE=2 SV=2
15	E3W6T6	4.79e-55	196	422	0.146	0.237	E3W6T6_DANRE T-box 5b isoform X1 OS=Danio rerio OX=7955 GN=si:dkey-114c15.2 PE=2 SV=1
16	Q9PWE8	5.88e-55	198	521	0.150	0.198	TBX5_CHICK T-box transcription factor TBX5 OS=Gallus gallus OX=9031 GN=TBX5 PE=1 SV=1
17	Q5I2P1	1.91e-54	197	517	0.149	0.197	TBX5_RAT T-box transcription factor TBX5 OS=Rattus norvegicus OX=10116 GN=Tbx5 PE=2 SV=1
18	Q24432	1.19e-53	201	972	0.137	0.097	OMB_DROME Optomotor-blind protein OS=Drosophila melanogaster OX=7227 GN=bi PE=1 SV=3
19	P57082	1.21e-53	195	545	0.162	0.204	TBX4_HUMAN T-box transcription factor TBX4 OS=Homo sapiens OX=9606 GN=TBX4 PE=1 SV=2
20	P70325	1.91e-53	194	552	0.143	0.178	TBX4_MOUSE T-box transcription factor TBX4 OS=Mus musculus OX=10090 GN=Tbx4 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00907 T-box	2.7e-71	250.8	T-box
2	PF16176 T-box_assoc	1.8e-100	347.3	T-box transcription factor-associated

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000388620

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262160	0.978	Mothers against decapentaplegic homolog 2
2	9606.ENSP00000404100	0.860	Paired box protein Pax-6
3	9606.ENSP00000254846	0.814	Lysine-specific demethylase 6B
4	9606.ENSP00000442439	0.804	Homeobox protein MIXL1
5	9606.ENSP00000370408	0.789	Homeobox protein CDX-2
6	9606.ENSP00000382800	0.773	Runt-related transcription factor 3
7	9606.ENSP00000368632	0.764	Trans-acting T-cell-specific transcription factor GATA-3
8	9606.ENSP00000216341	0.761	Granzyme B
9	9606.ENSP00000323588	0.761	Transcription factor SOX-2
10	9606.ENSP00000386559	0.758	T-cell surface glycoprotein CD8 alpha chain
11	9606.ENSP00000216223	0.751	Interleukin-2 receptor subunit beta
12	9606.ENSP00000349477	0.747	Killer cell lectin-like receptor subfamily G member 1
13	9606.ENSP00000398568	0.737	Perforin-1
14	9606.ENSP00000401112	0.736	DNA-binding protein SATB2
15	9606.ENSP00000353401	0.733	Homeobox protein cut-like 1
16	9606.ENSP00000357206	0.726	Nestin
17	9606.ENSP00000358092	0.722	PR domain zinc finger protein 1
18	9606.ENSP00000259915	0.721	POU domain, class 5, transcription factor 1
19	9606.ENSP00000349723	0.719	B-cell lymphoma/leukemia 11B
20	9606.ENSP00000306157	0.714	Interleukin-7 receptor subunit alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0140110	0.955	transcription regulator activity
GO:0003700	0.952	DNA-binding transcription factor activity
GO:0000981	0.902	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001067	0.895	transcription regulatory region nucleic acid binding
GO:0000976	0.894	transcription cis-regulatory region binding
GO:0000977	0.376	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0060255	0.995	regulation of macromolecule metabolic process
GO:0010468	0.994	regulation of gene expression
GO:2001141	0.992	regulation of RNA biosynthetic process
GO:0009987	0.990	cellular process
GO:0032501	0.988	multicellular organismal process
GO:0048856	0.985	anatomical structure development
GO:0048518	0.972	positive regulation of biological process
GO:0050896	0.963	response to stimulus
GO:0007275	0.949	multicellular organism development
GO:0006355	0.948	regulation of DNA-templated transcription
GO:0030154	0.921	cell differentiation
GO:0009893	0.915	positive regulation of metabolic process
GO:0010604	0.909	positive regulation of macromolecule metabolic process
GO:0048522	0.894	positive regulation of cellular process
GO:0006357	0.882	regulation of transcription by RNA polymerase II
GO:0048731	0.838	system development
GO:0048513	0.823	animal organ development
GO:0006955	0.817	immune response
GO:0002252	0.764	immune effector process
GO:0046649	0.756	lymphocyte activation
GO:0030217	0.751	T cell differentiation
GO:0031325	0.711	positive regulation of cellular metabolic process
GO:0051173	0.708	positive regulation of nitrogen compound metabolic process
GO:0031328	0.681	positive regulation of cellular biosynthetic process
GO:0010557	0.680	positive regulation of macromolecule biosynthetic process
GO:0045935	0.679	positive regulation of nucleobase-containing compound metabolic process
GO:0045893	0.668	positive regulation of DNA-templated transcription
GO:0002366	0.664	leukocyte activation involved in immune response
GO:0002285	0.595	lymphocyte activation involved in immune response
GO:0048519	0.544	negative regulation of biological process
GO:0046631	0.525	alpha-beta T cell activation
GO:0048523	0.454	negative regulation of cellular process
GO:0002286	0.422	T cell activation involved in immune response
GO:0046632	0.421	alpha-beta T cell differentiation
GO:0045944	0.410	positive regulation of transcription by RNA polymerase II
GO:0002292	0.347	T cell differentiation involved in immune response
GO:0009892	0.318	negative regulation of metabolic process
GO:0010605	0.302	negative regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.978	intracellular organelle lumen
GO:0005654	0.968	nucleoplasm
GO:0043228	0.808	non-membrane-bounded organelle
GO:0043232	0.804	intracellular non-membrane-bounded organelle
GO:0005737	0.685	cytoplasm
GO:0005694	0.366	chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]