StarFunc result for job id O95954

User Input

>input (541 residues)
MSQLVECVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVE
GALNAARVASRLIDMSRHQGEHPRMGALDVCPFIPVRGVSVDECVLCAQAFGQRLAEELD
VPVYLYGEAARMDSRRTLPAIRAGEYEALPKKLQQADWAPDFGPSSFVPSWGATATGARK
FLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEKNLAQVSTNLLD
FEVTALHTVYEETCREAQELSLPVVGSQLVGLVPLKALLDAAAFYCEKENLFILEEEQRI
RLVVSRLGLDSLCPFSPKERIIEYLVPERGPERGLGSKSLRAFVGEVGARSAAPGGGSVA
AAAAAMGAALGSMVGLMTYGRRQFQSLDTTMRRLIPPFREASAKLTTLVDADAEAFTAYL
EAMRLPKNTPEEKDRRTAALQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDL
QVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQ
E

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95954	1.000	1.000	4.779E-89	541	1.000	1.000	O95954.pdb.gz	FTCD_HUMAN Formimidoyltransferase-cyclodeaminase OS=Homo sapiens OX=9606 GN=FTCD PE=1 SV=2
2	AFDB:O88618	0.985	0.985	5.173E-80	541	0.848	0.848	O88618.pdb.gz	FTCD_RAT Formimidoyltransferase-cyclodeaminase OS=Rattus norvegicus OX=10116 GN=Ftcd PE=1 SV=4
3	AFDB:P53603	0.986	0.986	3.442E-79	541	0.850	0.850	P53603.pdb.gz	FTCD_PIG Formimidoyltransferase-cyclodeaminase OS=Sus scrofa OX=9823 GN=FTCD PE=1 SV=1
4	AFDB:Q9YH58	0.987	0.987	1.003E-72	541	0.706	0.706	Q9YH58.pdb.gz	FTCD_CHICK Formimidoyltransferase-cyclodeaminase OS=Gallus gallus OX=9031 GN=FTCD PE=1 SV=1
5	AFDB:Q7SXZ8	0.972	0.974	2.241E-70	540	0.660	0.661	Q7SXZ8.pdb.gz
6	PDB:1tt9A	0.866	0.867	9.635E-69	540	0.847	0.848	1tt9A.pdb.gz
7	AFDB:B7WPK3	0.769	0.840	1.475E-65	495	0.780	0.853	B7WPK3.pdb.gz	B7WPK3_HUMAN Formimidoyltransferase-cyclodeaminase OS=Homo sapiens OX=9606 GN=FTCD PE=1 SV=1
8	AFDB:Q9SKT4	0.429	0.766	3.540E-18	297	0.129	0.236	Q9SKT4.pdb.gz	FTCDL_ARATH Formiminotransferase cyclodeaminase-like protein OS=Arabidopsis thaliana OX=3702 GN=FTCD-L PE=2 SV=2
9	PDB:1q2lA	0.136	0.087	2.053E-3	937	0.065	0.037	1q2lA.pdb.gz	Crystal Structure of pitrilysin, the prototype of insulin-degrading enzymes
10	PDB:6ofsA	0.127	0.085	2.587E-3	905	0.072	0.043	6ofsA.pdb.gz	Protease-associated import systems are widespread in Gram-negative bacteria.
11	PDB:1hr6D	0.137	0.161	4.506E-3	443	0.067	0.081	1hr6D.pdb.gz	Crystal structures of mitochondrial processing peptidase reveal the mode for specific cleavage of import signal sequences.
12	PDB:7o37B	0.124	0.150	5.946E-3	420	0.076	0.098	7o37B.pdb.gz	Structure and assembly of the mammalian mitochondrial supercomplex CIII 2 CIV.
13	PDB:3hdiA	0.124	0.152	8.607E-3	414	0.067	0.087	3hdiA.pdb.gz	Crystal and solution structures of a prokaryotic M16B peptidase: an open and shut case.
14	PDB:3vcdA	0.139	0.357	8.607E-3	184	0.044	0.130	3vcdA.pdb.gz
15	AFDB:Q9XDM8	0.135	0.351	1.344E-2	184	0.043	0.125	Q9XDM8.pdb.gz	PDUT_SALTY Bacterial microcompartment shell protein PduT OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=pduT PE=1 SV=1
16	PDB:5xteK	0.133	0.162	1.499E-2	419	0.079	0.103	5xteK.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
17	PDB:1kb9A	0.123	0.145	1.644E-2	431	0.068	0.086	1kb9A.pdb.gz	SPECIFIC ROLES OF PROTEIN-PHOSPHOLIPID INTERACTIONS IN THE YEAST CYTOCHROME BC1 COMPLEX STRUCTURE
18	PDB:7o37A	0.141	0.161	2.170E-2	446	0.072	0.087	7o37A.pdb.gz	Structure and assembly of the mammalian mitochondrial supercomplex CIII 2 CIV.
19	AFDB:P42941	0.116	0.179	6.178E-2	309	0.085	0.149	P42941.pdb.gz	SERB_YEAST Phosphoserine phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SER2 PE=1 SV=1
20	AFDB:O74919	0.134	0.170	6.471E-2	398	0.076	0.103	O74919.pdb.gz	RNC1_SCHPO RNA-binding protein rnc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rnc1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B7WPK3	0.0	855	495	0.776	0.848	B7WPK3_HUMAN Formimidoyltransferase-cyclodeaminase OS=Homo sapiens OX=9606 GN=FTCD PE=1 SV=1
2	O88618	0.0	911	541	0.848	0.848	FTCD_RAT Formimidoyltransferase-cyclodeaminase OS=Rattus norvegicus OX=10116 GN=Ftcd PE=1 SV=4
3	O95954	0.0	1103	541	1.000	1.000	FTCD_HUMAN Formimidoyltransferase-cyclodeaminase OS=Homo sapiens OX=9606 GN=FTCD PE=1 SV=2
4	P53603	0.0	925	541	0.850	0.850	FTCD_PIG Formimidoyltransferase-cyclodeaminase OS=Sus scrofa OX=9823 GN=FTCD PE=1 SV=1
5	Q91XD4	0.0	910	541	0.845	0.845	FTCD_MOUSE Formimidoyltransferase-cyclodeaminase OS=Mus musculus OX=10090 GN=Ftcd PE=1 SV=1
6	Q9YH58	0.0	786	541	0.708	0.708	FTCD_CHICK Formimidoyltransferase-cyclodeaminase OS=Gallus gallus OX=9031 GN=FTCD PE=1 SV=1
7	Q9SKT4	1.24e-13	73.9	297	0.126	0.229	FTCDL_ARATH Formiminotransferase cyclodeaminase-like protein OS=Arabidopsis thaliana OX=3702 GN=FTCD-L PE=2 SV=2
8	Q06336	4.5	32.3	557	0.039	0.038	GGA1_YEAST ADP-ribosylation factor-binding protein GGA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GGA1 PE=1 SV=1
9	O15909	4.8	32.3	838	0.046	0.030	RIR1_TRYBB Ribonucleoside-diphosphate reductase large subunit OS=Trypanosoma brucei brucei OX=5702 GN=RNR1 PE=1 SV=1
10	Q9NXZ1	4.8	32.7	904	0.037	0.022	SAGE1_HUMAN Sarcoma antigen 1 OS=Homo sapiens OX=9606 GN=SAGE1 PE=1 SV=2
11	B2RHG5	5.8	32.3	1228	0.067	0.029	MFA5_PORG3 Minor fimbrium subunit Mfa5 OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561) OX=431947 GN=PGN_0291 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02971 FTCD	1.6e-62	221.2	Formiminotransferase domain
2	PF04961 FTCD_C	7.4e-65	229.6	Formiminotransferase-cyclodeaminase
3	PF07837 FTCD_N	5e-68	239.8	Formiminotransferase domain, N-terminal subdomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000291670

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000266736	0.974	Probable imidazolonepropionase
2	9606.ENSP00000216605	0.960	C-1-tetrahydrofolate synthase, cytoplasmic
3	9606.ENSP00000478253	0.953	Monofunctional C1-tetrahydrofolate synthase, mitochondrial
4	9606.ENSP00000333667	0.951	Serine hydroxymethyltransferase, mitochondrial
5	9606.ENSP00000258874	0.950	5-formyltetrahydrofolate cyclo-ligase
6	9606.ENSP00000377617	0.947	Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial
7	9606.ENSP00000318868	0.946	Serine hydroxymethyltransferase, cytosolic
8	9606.ENSP00000273588	0.942	Aminomethyltransferase, mitochondrial
9	9606.ENSP00000273450	0.932	Cytosolic 10-formyltetrahydrofolate dehydrogenase
10	9606.ENSP00000373073	0.931	Urocanate hydratase 1
11	9606.ENSP00000379108	0.929	Probable bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase 2
12	9606.ENSP00000455643	0.926	5-formyltetrahydrofolate cyclo-ligase
13	9606.ENSP00000355536	0.923	Methionine synthase
14	9606.ENSP00000396308	0.920	Dihydrofolate reductase
15	9606.ENSP00000258494	0.919	Mitochondrial 10-formyltetrahydrofolate dehydrogenase
16	9606.ENSP00000236959	0.918	Bifunctional purine biosynthesis protein PURH
17	9606.ENSP00000377768	0.909	Dihydrofolate reductase 2, mitochondrial
18	9606.ENSP00000220058	0.903	Methionyl-tRNA formyltransferase, mitochondrial
19	9606.ENSP00000371253	0.900	Trifunctional purine biosynthetic protein adenosine-3
20	9606.ENSP00000361471	0.866	Argininosuccinate synthase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030409	1.000	glutamate formimidoyltransferase activity
GO:0030412	0.999	formimidoyltetrahydrofolate cyclodeaminase activity
GO:0005515	0.998	protein binding
GO:0008017	0.984	microtubule binding
GO:0044877	0.325	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.998	cellular metabolic process
GO:1901564	0.998	organonitrogen compound metabolic process
GO:0044238	0.977	primary metabolic process
GO:0044281	0.925	small molecule metabolic process
GO:0043436	0.917	oxoacid metabolic process
GO:0019752	0.912	carboxylic acid metabolic process
GO:0006520	0.898	amino acid metabolic process
GO:1901360	0.795	organic cyclic compound metabolic process
GO:0006575	0.787	cellular modified amino acid metabolic process
GO:0006725	0.777	cellular aromatic compound metabolic process
GO:0046483	0.764	heterocycle metabolic process
GO:0042558	0.698	pteridine-containing compound metabolic process
GO:0006547	0.672	histidine metabolic process
GO:0009056	0.658	catabolic process
GO:1901575	0.636	organic substance catabolic process
GO:0046395	0.438	carboxylic acid catabolic process
GO:0009063	0.419	amino acid catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	0.999	Golgi apparatus
GO:0016020	0.962	membrane
GO:0005829	0.943	cytosol
GO:0031090	0.730	organelle membrane
GO:0098588	0.563	bounding membrane of organelle
GO:0005576	0.518	extracellular region
GO:0005783	0.514	endoplasmic reticulum
GO:0031982	0.458	vesicle
GO:0005886	0.359	plasma membrane
GO:0070013	0.354	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:15097	1.000	5-formimidoyltetrahydrofolate + L-glutamate = (6S)-5,6,7,8-tetrahydrofolate + N-formimidoyl-L-glutamate
EC:2.1.2.5	1.000	glutamate formimidoyltransferase.
RHEA:22736	0.999	5-formimidoyltetrahydrofolate + 2 H(+) = (6R)-5,10-methenyltetrahydrofolate + NH4(+)
EC:4.3.1.4	0.999	formimidoyltetrahydrofolate cyclodeaminase.

[back to server]