StarFunc result for job id O95970

User Input

>input (557 residues)
MESERSKRMGNACIPLKRIAYFLCLLSALLLTEGKKPAKPKCPAVCTCTKDNALCENARS
IPRTVPPDVISLSFVRSGFTEISEGSFLFTPSLQLLLFTSNSFDVISDDAFIGLPHLEYL
FIENNNIKSISRHTFRGLKSLIHLSLANNNLQTLPKDIFKGLDSLTNVDLRGNSFNCDCK
LKWLVEWLGHTNATVEDIYCEGPPEYKKRKINSLSSKDFDCIITEFAKSQDLPYQSLSID
TFSYLNDEYVVIAQPFTGKCIFLEWDHVEKTFRNYDNITGTSTVVCKPIVIETQLYVIVA
QLFGGSHIYKRDSFANKFIKIQDIEILKIRKPNDIETFKIENNWYFVVADSSKAGFTTIY
KWNGNGFYSHQSLHAWYRDTDVEYLEIVRTPQTLRTPHLILSSSSQRPVIYQWNKATQLF
TNQTDIPNMEDVYAVKHFSVKGDVYICLTRFIGDSKVMKWGGSSFQDIQRMPSRGSMVFQ
PLQINNYQYAILGSDYSFTQVYNWDAEKAKFVKFQELNVQAPRSFTHVSINKRNFLFASS
FKGNTQIYKHVIVDLSA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95970	1.000	1.000	0.000	557	1.000	1.000	O95970.pdb.gz	LGI1_HUMAN Leucine-rich glioma-inactivated protein 1 OS=Homo sapiens OX=9606 GN=LGI1 PE=1 SV=1
2	PDB:5y31B	0.744	0.802	2.552E-93	511	0.916	0.998	5y31B.pdb.gz	Structural basis of epilepsy-related ligand-receptor complex LGI1-ADAM22.
3	AFDB:B3DJS9	0.881	0.903	3.508E-85	543	0.673	0.691	B3DJS9.pdb.gz	B3DJS9_DANRE Leucine-rich glioma-inactivated protein 1 precursor OS=Danio rerio OX=7955 GN=lgi1b PE=2 SV=1
4	AFDB:Q2HPG2	0.884	0.916	4.354E-83	537	0.634	0.657	Q2HPG2.pdb.gz	Q2HPG2_DANRE LGIa (Fragment) OS=Danio rerio OX=7955 GN=LGIa PE=2 SV=1
5	AFDB:Q8K406	0.893	0.907	1.541E-71	548	0.510	0.518	Q8K406.pdb.gz	LGI3_MOUSE Leucine-rich repeat LGI family member 3 OS=Mus musculus OX=10090 GN=Lgi3 PE=1 SV=1
6	AFDB:Q8N0V4	0.872	0.890	1.235E-70	545	0.540	0.552	Q8N0V4.pdb.gz	LGI2_HUMAN Leucine-rich repeat LGI family member 2 OS=Homo sapiens OX=9606 GN=LGI2 PE=2 SV=1
7	AFDB:Q8K1S1	0.689	0.710	6.345E-68	537	0.467	0.484	Q8K1S1.pdb.gz	LGI4_MOUSE Leucine-rich repeat LGI family member 4 OS=Mus musculus OX=10090 GN=Lgi4 PE=1 SV=1
8	AFDB:Q8N135	0.698	0.720	5.347E-67	537	0.478	0.495	Q8N135.pdb.gz	LGI4_HUMAN Leucine-rich repeat LGI family member 4 OS=Homo sapiens OX=9606 GN=LGI4 PE=1 SV=1
9	AFDB:Q8K4Z0	0.589	0.596	6.762E-66	550	0.517	0.524	Q8K4Z0.pdb.gz	LGI2_MOUSE Leucine-rich repeat LGI family member 2 OS=Mus musculus OX=10090 GN=Lgi2 PE=2 SV=1
10	AFDB:J3S6Y1	0.525	0.440	5.119E-19	670	0.104	0.087	J3S6Y1.pdb.gz	TSEAR_MOUSE Thrombospondin-type laminin G domain and EAR repeat-containing protein OS=Mus musculus OX=10090 GN=Tspear PE=1 SV=1
11	AFDB:Q8WU66	0.528	0.442	1.731E-18	669	0.101	0.084	Q8WU66.pdb.gz	TSEAR_HUMAN Thrombospondin-type laminin G domain and EAR repeat-containing protein OS=Homo sapiens OX=9606 GN=TSPEAR PE=1 SV=2
12	PDB:7mq8LS	0.420	0.503	2.277E-9	453	0.068	0.084	7mq8LS.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:7mgmC	0.432	0.652	4.875E-9	348	0.084	0.135	7mgmC.pdb.gz	Structural basis for cytoplasmic dynein-1 regulation by Lis1.
14	PDB:5lj5t	0.353	0.423	8.097E-9	438	0.084	0.107	5lj5t.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
15	PDB:1yfqA	0.407	0.615	1.279E-8	342	0.081	0.132	1yfqA.pdb.gz	The 1.1-a structure of the spindle checkpoint protein bub3p reveals functional regions.
16	PDB:5jpqY	0.380	0.544	1.734E-8	365	0.083	0.126	5jpqY.pdb.gz	Architecture of the 90S Pre-ribosome: A Structural View on the Birth of the Eukaryotic Ribosome.
17	PDB:7lhwA	0.407	0.143	1.824E-8	1813	0.052	0.016	7lhwA.pdb.gz	Structural analysis of the full-length human LRRK2.
18	PDB:7ajtUR	0.458	0.521	3.353E-8	482	0.056	0.064	7ajtUR.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
19	PDB:7kzmD	0.446	0.530	4.547E-8	456	0.075	0.092	7kzmD.pdb.gz	Structure of a microtubule-bound axonemal dynein.
20	PDB:7nsbg	0.415	0.520	4.547E-8	429	0.083	0.107	7nsbg.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B3DJS9	0.0	809	543	0.673	0.691	B3DJS9_DANRE Leucine-rich glioma-inactivated protein 1 precursor OS=Danio rerio OX=7955 GN=lgi1b PE=2 SV=1
2	F1R662	0.0	813	543	0.675	0.692	F1R662_DANRE Leucine-rich glioma-inactivated protein 1 isoform X1 OS=Danio rerio OX=7955 GN=lgi1b PE=4 SV=1
3	O95970	0.0	1159	557	1.000	1.000	LGI1_HUMAN Leucine-rich glioma-inactivated protein 1 OS=Homo sapiens OX=9606 GN=LGI1 PE=1 SV=1
4	Q2HPG2	0.0	761	537	0.623	0.646	Q2HPG2_DANRE LGIa (Fragment) OS=Danio rerio OX=7955 GN=LGIa PE=2 SV=1
5	Q8K1S1	0.0	539	537	0.456	0.473	LGI4_MOUSE Leucine-rich repeat LGI family member 4 OS=Mus musculus OX=10090 GN=Lgi4 PE=1 SV=1
6	Q8K406	0.0	606	548	0.490	0.498	LGI3_MOUSE Leucine-rich repeat LGI family member 3 OS=Mus musculus OX=10090 GN=Lgi3 PE=1 SV=1
7	Q8K4Y5	0.0	1126	557	0.969	0.969	LGI1_RAT Leucine-rich glioma-inactivated protein 1 OS=Rattus norvegicus OX=10116 GN=Lgi1 PE=1 SV=1
8	Q8K4Z0	0.0	543	550	0.508	0.515	LGI2_MOUSE Leucine-rich repeat LGI family member 2 OS=Mus musculus OX=10090 GN=Lgi2 PE=2 SV=1
9	Q8N0V4	0.0	619	545	0.533	0.545	LGI2_HUMAN Leucine-rich repeat LGI family member 2 OS=Homo sapiens OX=9606 GN=LGI2 PE=2 SV=1
10	Q8N135	0.0	553	537	0.465	0.482	LGI4_HUMAN Leucine-rich repeat LGI family member 4 OS=Homo sapiens OX=9606 GN=LGI4 PE=1 SV=1
11	Q8N145	0.0	602	548	0.487	0.495	LGI3_HUMAN Leucine-rich repeat LGI family member 3 OS=Homo sapiens OX=9606 GN=LGI3 PE=1 SV=1
12	Q9JIA1	0.0	1129	557	0.969	0.969	LGI1_MOUSE Leucine-rich glioma-inactivated protein 1 OS=Mus musculus OX=10090 GN=Lgi1 PE=1 SV=1
13	F1RCV3	5.03e-22	103	1516	0.106	0.039	F1RCV3_DANRE Slit homolog 3 (Drosophila) OS=Danio rerio OX=7955 GN=zgc:111911 PE=1 SV=1
14	Q90XG4	2.57e-20	97.8	1095	0.102	0.052	Q90XG4_CHICK Slit-3 (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
15	O75094	4.75e-20	97.1	1523	0.104	0.038	SLIT3_HUMAN Slit homolog 3 protein OS=Homo sapiens OX=9606 GN=SLIT3 PE=2 SV=3
16	P24014	5.64e-20	96.7	1504	0.124	0.046	SLIT_DROME Protein slit OS=Drosophila melanogaster OX=7227 GN=sli PE=1 SV=2
17	Q9WVB4	6.08e-20	96.7	1523	0.097	0.035	SLIT3_MOUSE Slit homolog 3 protein OS=Mus musculus OX=10090 GN=Slit3 PE=2 SV=2
18	O88280	1.17e-19	95.9	1523	0.097	0.035	SLIT3_RAT Slit homolog 3 protein OS=Rattus norvegicus OX=10116 GN=Slit3 PE=2 SV=1
19	Q3S2J2	1.17e-19	95.9	1524	0.110	0.040	Q3S2J2_DANRE Slit homolog 1 protein precursor OS=Danio rerio OX=7955 GN=slit1a PE=1 SV=1
20	Q9R1B9	4.07e-19	94.0	1521	0.108	0.039	SLIT2_MOUSE Slit homolog 2 protein OS=Mus musculus OX=10090 GN=Slit2 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03736 EPTP	5.9e-64	223.2	EPTP domain
2	PF01463 LRRCT	2.7e+02	13.6	Leucine rich repeat C-terminal domain
3	PF12799 LRR_4	0.00056	31.5	Leucine Rich repeats (2 copies)
4	PF13306 LRR_5	0.00065	31.1	BspA type Leucine rich repeat region (6 copies)
5	PF13855 LRR_8	5.1e-19	79.1	Leucine rich repeat
6	PF14580 LRR_9	73	14.4	Leucine-rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000015659

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000018336	0.985	ADAM metallopeptidase domain 22
2	61853.ENSNLEP00000009746	0.931	Discs, large homolog 4 (Drosophila)
3	61853.ENSNLEP00000008663	0.909	ADAM metallopeptidase domain 23
4	61853.ENSNLEP00000006328	0.886	ADAM metallopeptidase domain 11
5	61853.ENSNLEP00000019382	0.806	ADAM metallopeptidase domain 28
6	61853.ENSNLEP00000017831	0.776	Multifunctional fusion protein
7	61853.ENSNLEP00000022702	0.705	Potassium voltage-gated channel, shaker-related subfamily, member 1 (episodic ataxia with myokymia)
8	61853.ENSNLEP00000004175	0.699	Contactin associated protein-like 2
9	61853.ENSNLEP00000017760	0.693	Peptidase M20 domain containing 1
10	61853.ENSNLEP00000003601	0.690	Solute carrier family 17 (organic anion transporter), member 3
11	61853.ENSNLEP00000019977	0.670	Discs, large homolog 2 (Drosophila)
12	61853.ENSNLEP00000015342	0.648	Corticotropin-releasing factor-binding protein
13	61853.ENSNLEP00000016459	0.647	Delta/notch-like EGF repeat containing
14	61853.ENSNLEP00000022930	0.645	Paraneoplastic Ma antigen 2
15	61853.ENSNLEP00000004778	0.640	Potassium voltage-gated channel, shaker-related subfamily, beta member 1
16	61853.ENSNLEP00000003088	0.637	Dihydropyrimidinase-like 5
17	61853.ENSNLEP00000007101	0.626	IgLON family member 5
18	61853.ENSNLEP00000017507	0.620	Contactin 2 (axonal)
19	61853.ENSNLEP00000001035	0.614	ADAM metallopeptidase domain 12
20	61853.ENSNLEP00000005017	0.613	ADAM metallopeptidase domain 19

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.545	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0032501	0.965	multicellular organismal process
GO:0007275	0.936	multicellular organism development
GO:0048731	0.901	system development
GO:0048518	0.881	positive regulation of biological process
GO:0048522	0.864	positive regulation of cellular process
GO:0051179	0.842	localization
GO:0065008	0.810	regulation of biological quality
GO:0023051	0.807	regulation of signaling
GO:0010646	0.807	regulation of cell communication
GO:1902414	0.755	protein localization to cell junction
GO:0050896	0.715	response to stimulus
GO:0007399	0.662	nervous system development
GO:0071840	0.644	cellular component organization or biogenesis
GO:0099177	0.642	regulation of trans-synaptic signaling
GO:0016043	0.629	cellular component organization
GO:0050804	0.575	modulation of chemical synaptic transmission
GO:0031503	0.571	protein-containing complex localization
GO:0099072	0.564	regulation of postsynaptic membrane neurotransmitter receptor levels
GO:0023056	0.552	positive regulation of signaling
GO:0010647	0.493	positive regulation of cell communication
GO:0035418	0.453	protein localization to synapse
GO:0030030	0.345	cell projection organization
GO:0009653	0.337	anatomical structure morphogenesis
GO:0048869	0.320	cellular developmental process
GO:0042221	0.307	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0005576	0.978	extracellular region
GO:0005615	0.947	extracellular space
GO:0005737	0.736	cytoplasm
GO:0071944	0.517	cell periphery
GO:0005886	0.511	plasma membrane
GO:0043226	0.464	organelle
GO:0043227	0.408	membrane-bounded organelle
GO:0043229	0.400	intracellular organelle
GO:0030054	0.387	cell junction
GO:0045202	0.358	synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]