StarFunc result for job id O95971

User Input

>input (181 residues)
MLLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFL
CKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSG
IRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSSGFLQEKVWVMLVTSLVALQA
L

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95971	1.000	1.000	2.951E-31	181	1.000	1.000	O95971.pdb.gz	BY55_HUMAN CD160 antigen OS=Homo sapiens OX=9606 GN=CD160 PE=1 SV=1
2	AFDB:O88875	0.657	0.644	4.242E-20	185	0.641	0.627	O88875.pdb.gz	BY55_MOUSE CD160 antigen OS=Mus musculus OX=10090 GN=Cd160 PE=1 SV=2
3	AFDB:Q8NET5	0.392	0.281	1.397E-4	270	0.138	0.093	Q8NET5.pdb.gz	NFAM1_HUMAN NFAT activation molecule 1 OS=Homo sapiens OX=9606 GN=NFAM1 PE=1 SV=1
4	AFDB:Q3UKC1	0.411	0.114	2.530E-4	814	0.138	0.031	Q3UKC1.pdb.gz	TAXB1_MOUSE Tax1-binding protein 1 homolog OS=Mus musculus OX=10090 GN=Tax1bp1 PE=1 SV=2
5	AFDB:Q9I8F3	0.396	0.160	3.498E-4	539	0.149	0.050	Q9I8F3.pdb.gz	Q9I8F3_CHICK Muscle-derived protein 62 OS=Gallus gallus OX=9031 GN=MDP62 PE=2 SV=1
6	AFDB:Q6UX27	0.336	0.265	6.000E-4	236	0.110	0.085	Q6UX27.pdb.gz	VSTM1_HUMAN V-set and transmembrane domain-containing protein 1 OS=Homo sapiens OX=9606 GN=VSTM1 PE=1 SV=2
7	AFDB:Q86VP1	0.411	0.117	6.000E-4	789	0.133	0.030	Q86VP1.pdb.gz	TAXB1_HUMAN Tax1-binding protein 1 OS=Homo sapiens OX=9606 GN=TAX1BP1 PE=1 SV=2
8	PDB:5ir3A	0.345	0.517	6.906E-4	111	0.105	0.171	5ir3A.pdb.gz
9	AFDB:B6A8C7	0.344	0.246	8.295E-4	271	0.144	0.096	B6A8C7.pdb.gz	TARM1_HUMAN T-cell-interacting, activating receptor on myeloid cells protein 1 OS=Homo sapiens OX=9606 GN=TARM1 PE=1 SV=2
10	AFDB:A0A024RAZ1	0.381	0.122	1.210E-3	691	0.099	0.026	A0A024RAZ1.pdb.gz
11	AFDB:Q00495	0.359	0.084	1.348E-3	978	0.122	0.022	Q00495.pdb.gz	CSF1R_RAT Macrophage colony-stimulating factor 1 receptor OS=Rattus norvegicus OX=10116 GN=Csf1r PE=1 SV=1
12	PDB:5ijdC	0.268	0.320	3.681E-3	137	0.088	0.117	5ijdC.pdb.gz	TLR4/MD-2 activation by a synthetic agonist with no similarity to LPS.
13	PDB:3zhlA	0.323	0.449	5.088E-3	121	0.088	0.132	3zhlA.pdb.gz
14	PDB:2ag2A	0.235	0.250	8.729E-3	164	0.116	0.128	2ag2A.pdb.gz	Crystal Structure Analysis of Phosphatidylcholine-GM2-Activator Product Complexes: Evidence for Hydrolase Activity.
15	PDB:2cd0A	0.348	0.529	9.724E-3	111	0.116	0.189	2cd0A.pdb.gz
16	PDB:4y5xB	0.336	0.498	1.026E-2	111	0.094	0.153	4y5xB.pdb.gz
17	PDB:1cd0A	0.340	0.511	1.274E-2	111	0.099	0.162	1cd0A.pdb.gz
18	PDB:1jv5A	0.267	0.405	1.274E-2	107	0.105	0.178	1jv5A.pdb.gz
19	PDB:8e4cC	0.255	0.301	1.274E-2	142	0.127	0.162	8e4cC.pdb.gz
20	PDB:2q20B	0.256	0.386	1.344E-2	109	0.105	0.174	2q20B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95971	9.97e-133	370	181	1.000	1.000	BY55_HUMAN CD160 antigen OS=Homo sapiens OX=9606 GN=CD160 PE=1 SV=1
2	O88875	8.84e-84	247	185	0.663	0.649	BY55_MOUSE CD160 antigen OS=Mus musculus OX=10090 GN=Cd160 PE=1 SV=2
3	Q9UQ72	0.072	35.4	335	0.088	0.048	PSG11_HUMAN Pregnancy-specific beta-1-glycoprotein 11 OS=Homo sapiens OX=9606 GN=PSG11 PE=2 SV=3
4	Q8MSY2	0.27	33.5	188	0.110	0.106	Q8MSY2_DROME LD08354p OS=Drosophila melanogaster OX=7227 GN=Dis3 PE=2 SV=1
5	Q9P7V9	0.37	33.5	585	0.116	0.036	UBP9_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp9 PE=1 SV=1
6	Q8N743	0.46	33.1	410	0.122	0.054	KI3L3_HUMAN Killer cell immunoglobulin-like receptor 3DL3 OS=Homo sapiens OX=9606 GN=KIR3DL3 PE=1 SV=2
7	F1N9Z6	0.48	33.5	1587	0.155	0.018	F1N9Z6_CHICK Myomesin 1 OS=Gallus gallus OX=9031 GN=MYOM1 PE=4 SV=4
8	Q960A7	0.63	32.7	982	0.110	0.020	Q960A7_DROME SD10981p OS=Drosophila melanogaster OX=7227 GN=Dis3 PE=2 SV=1
9	Q9BI20	0.63	32.7	983	0.110	0.020	Q9BI20_DROME Putative exoribonuclease DIS3 OS=Drosophila melanogaster OX=7227 GN=Dis3 PE=2 SV=1
10	Q9VC93	0.63	32.7	982	0.110	0.020	Q9VC93_DROME Dis3, isoform A OS=Drosophila melanogaster OX=7227 GN=Dis3 PE=1 SV=1
11	P01024	0.65	32.7	1663	0.160	0.017	CO3_HUMAN Complement C3 OS=Homo sapiens OX=9606 GN=C3 PE=1 SV=2
12	Q99706	1.1	32.0	377	0.155	0.074	KI2L4_HUMAN Killer cell immunoglobulin-like receptor 2DL4 OS=Homo sapiens OX=9606 GN=KIR2DL4 PE=1 SV=3
13	Q16557	1.9	31.2	428	0.083	0.035	PSG3_HUMAN Pregnancy-specific beta-1-glycoprotein 3 OS=Homo sapiens OX=9606 GN=PSG3 PE=2 SV=2
14	A0A8I6GBP8	2.5	31.2	1689	0.171	0.018	A0A8I6GBP8_RAT Myomesin 1 OS=Rattus norvegicus OX=10116 GN=Myom1 PE=1 SV=1
15	A0A8I6GFM8	2.5	31.2	1592	0.171	0.019	A0A8I6GFM8_RAT Myomesin 1 OS=Rattus norvegicus OX=10116 GN=Myom1 PE=1 SV=1
16	Q00889	3.4	30.4	435	0.083	0.034	PSG6_HUMAN Pregnancy-specific beta-1-glycoprotein 6 OS=Homo sapiens OX=9606 GN=PSG6 PE=2 SV=1
17	P59901	3.8	30.4	499	0.138	0.050	LIRA4_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 4 OS=Homo sapiens OX=9606 GN=LILRA4 PE=1 SV=3
18	Q84TE6	4.1	30.0	324	0.127	0.071	NAC22_ARATH NAC domain-containing protein 21/22 OS=Arabidopsis thaliana OX=3702 GN=NAC021 PE=1 SV=2
19	Q05017	4.9	30.0	1458	0.149	0.019	PLB1_RABIT Phospholipase B1, membrane-associated OS=Oryctolagus cuniculus OX=9986 GN=PLB1 PE=1 SV=1
20	Q07699	4.9	29.6	218	0.215	0.179	SCN1B_HUMAN Sodium channel subunit beta-1 OS=Homo sapiens OX=9606 GN=SCN1B PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07679 I-set	3.3e+02	12.8	Immunoglobulin I-set domain
2	PF00047 ig	6.1	18.4	Immunoglobulin domain
3	PF13895 Ig_2	0.26	22.9	Immunoglobulin domain
4	PF13927 Ig_3	0.041	25.8	Immunoglobulin domain
5	PF07686 V-set	0.2	23.2	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000235933

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000347948	0.990	Tumor necrosis factor receptor superfamily member 14
2	9606.ENSP00000365402	0.975	HLA class I histocompatibility antigen, Cw-7 alpha chain
3	9606.ENSP00000412927	0.975	HLA class I histocompatibility antigen, alpha chain G
4	9606.ENSP00000333919	0.859	B- and T-lymphocyte attenuator
5	9606.ENSP00000203629	0.831	Lymphocyte activation gene 3 protein
6	9606.ENSP00000312002	0.775	Hepatitis A virus cellular receptor 2
7	9606.ENSP00000357012	0.751	Natural killer cell receptor 2B4
8	9606.ENSP00000365817	0.733	HLA class I histocompatibility antigen, alpha chain E
9	9606.ENSP00000386559	0.692	T-cell surface glycoprotein CD8 alpha chain
10	9606.ENSP00000303939	0.687	Cytotoxic T-lymphocyte protein 4
11	9606.ENSP00000349477	0.684	Killer cell lectin-like receptor subfamily G member 1
12	9606.ENSP00000419085	0.681	T-cell immunoreceptor with Ig and ITIM domains
13	9606.ENSP00000379873	0.680	HLA class I histocompatibility antigen, A-3 alpha chain
14	9606.ENSP00000469049	0.663	Tumor necrosis factor ligand superfamily member 14
15	9606.ENSP00000452780	0.657	Beta-2-microglobulin
16	9606.ENSP00000399168	0.655	HLA class I histocompatibility antigen, B-7 alpha chain
17	9606.ENSP00000335062	0.645	Programmed cell death protein 1
18	9606.ENSP00000259951	0.635	HLA class I histocompatibility antigen, alpha chain F
19	9606.ENSP00000370989	0.616	Programmed cell death 1 ligand 1
20	9606.ENSP00000011653	0.602	T-cell surface glycoprotein CD4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	0.996	signaling receptor binding
GO:0038023	0.990	signaling receptor activity
GO:0004888	0.964	transmembrane signaling receptor activity
GO:0140375	0.950	immune receptor activity
GO:0019899	0.947	enzyme binding
GO:0019900	0.932	kinase binding
GO:0032394	0.582	MHC class Ib receptor activity
GO:0032397	0.446	activating MHC class I receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.997	response to stimulus
GO:0048518	0.995	positive regulation of biological process
GO:0002376	0.994	immune system process
GO:0032101	0.993	regulation of response to external stimulus
GO:0051239	0.990	regulation of multicellular organismal process
GO:0002831	0.989	regulation of response to biotic stimulus
GO:0007165	0.989	signal transduction
GO:0060255	0.988	regulation of macromolecule metabolic process
GO:0031347	0.988	regulation of defense response
GO:0050778	0.988	positive regulation of immune response
GO:0048519	0.986	negative regulation of biological process
GO:0002708	0.982	positive regulation of lymphocyte mediated immunity
GO:0002696	0.980	positive regulation of leukocyte activation
GO:0045089	0.980	positive regulation of innate immune response
GO:1903037	0.979	regulation of leukocyte cell-cell adhesion
GO:0050863	0.978	regulation of T cell activation
GO:0001819	0.975	positive regulation of cytokine production
GO:0051251	0.972	positive regulation of lymphocyte activation
GO:0002715	0.968	regulation of natural killer cell mediated immunity
GO:0002717	0.962	positive regulation of natural killer cell mediated immunity
GO:0042981	0.957	regulation of apoptotic process
GO:0045785	0.945	positive regulation of cell adhesion
GO:0002683	0.934	negative regulation of immune system process
GO:0002700	0.934	regulation of production of molecular mediator of immune response
GO:1903039	0.932	positive regulation of leukocyte cell-cell adhesion
GO:2000026	0.917	regulation of multicellular organismal development
GO:0042269	0.917	regulation of natural killer cell mediated cytotoxicity
GO:0031343	0.901	positive regulation of cell killing
GO:0048523	0.881	negative regulation of cellular process
GO:0051241	0.879	negative regulation of multicellular organismal process
GO:0002819	0.867	regulation of adaptive immune response
GO:0045954	0.863	positive regulation of natural killer cell mediated cytotoxicity
GO:0051050	0.860	positive regulation of transport
GO:0002702	0.843	positive regulation of production of molecular mediator of immune response
GO:1903305	0.796	regulation of regulated secretory pathway
GO:0006955	0.795	immune response
GO:0002718	0.782	regulation of cytokine production involved in immune response
GO:0050870	0.776	positive regulation of T cell activation
GO:0010646	0.767	regulation of cell communication
GO:0023051	0.737	regulation of signaling
GO:1903532	0.735	positive regulation of secretion by cell
GO:0048585	0.729	negative regulation of response to stimulus
GO:2000351	0.725	regulation of endothelial cell apoptotic process
GO:0043300	0.707	regulation of leukocyte degranulation
GO:1903307	0.695	positive regulation of regulated secretory pathway
GO:0048017	0.650	inositol lipid-mediated signaling
GO:0006950	0.622	response to stress
GO:0046634	0.607	regulation of alpha-beta T cell activation
GO:0050777	0.599	negative regulation of immune response
GO:0048015	0.572	phosphatidylinositol-mediated signaling
GO:0002720	0.560	positive regulation of cytokine production involved in immune response
GO:0043068	0.532	positive regulation of programmed cell death
GO:0032501	0.510	multicellular organismal process
GO:0032814	0.498	regulation of natural killer cell activation
GO:0009966	0.490	regulation of signal transduction
GO:0043302	0.458	positive regulation of leukocyte degranulation
GO:0007166	0.393	cell surface receptor signaling pathway
GO:0031323	0.340	regulation of cellular metabolic process
GO:0006952	0.322	defense response
GO:2000514	0.317	regulation of CD4-positive, alpha-beta T cell activation
GO:0042127	0.307	regulation of cell population proliferation
GO:1904037	0.303	positive regulation of epithelial cell apoptotic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043226	0.323	organelle
GO:0005622	0.316	intracellular anatomical structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]