StarFunc result for job id O95972

User Input

>input (392 residues)
MVLLSILRILFLCELVLFMEHRAQMAEGGQSSIALLAEAPTLPLIEELLEESPGEQPRKP
RLLGHSLRYMLELYRRSADSHGHPRENRTIGATMVRLVKPLTNVARPHRGTWHIQILGFP
LRPNRGLYQLVRATVVYRHHLQLTRFNLSCHVEPWVQKNPTNHFPSSEGDSSKPSLMSNA
WKEMDITQLVQQRFWNNKGHRILRLRFMCQQQKDSGGLELWHGTSSLDIAFLLLYFNDTH
KSIRKAKFLPRGMEEFMERESLLRRTRQADGISAEVTASSSKHSGPENNQCSLHPFQISF
RQLGWDHWIIAPPFYTPNYCKGTCLRVLRDGLNSPNHAIIQNLINQLVDQSVPRPSCVPY
KYVPISVLMIEANGSILYKEYEGMIAESCTCR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95972	1.000	1.000	1.607E-73	392	1.000	1.000	O95972.pdb.gz	BMP15_HUMAN Bone morphogenetic protein 15 OS=Homo sapiens OX=9606 GN=BMP15 PE=1 SV=2
2	AFDB:Q8WMY6	0.803	0.799	2.104E-52	394	0.737	0.734	Q8WMY6.pdb.gz	Q8WMY6_PIG Bone morphogenetic protein 15 OS=Sus scrofa OX=9823 GN=BMP15 PE=3 SV=2
3	AFDB:Q9Z0L4	0.757	0.757	4.169E-47	392	0.635	0.635	Q9Z0L4.pdb.gz	BMP15_MOUSE Bone morphogenetic protein 15 OS=Mus musculus OX=10090 GN=Bmp15 PE=2 SV=1
4	AFDB:E9PTU9	0.765	0.767	5.780E-47	391	0.635	0.637	E9PTU9.pdb.gz	E9PTU9_RAT Bone morphogenetic protein 15 OS=Rattus norvegicus OX=10116 GN=Bmp15 PE=3 SV=1
5	AFDB:Q32PR5	0.613	0.578	1.197E-23	418	0.283	0.266	Q32PR5.pdb.gz
6	AFDB:O60383	0.600	0.524	2.709E-23	454	0.319	0.275	O60383.pdb.gz	GDF9_HUMAN Growth/differentiation factor 9 OS=Homo sapiens OX=9606 GN=GDF9 PE=1 SV=1
7	AFDB:Q0VG66	0.585	0.582	2.860E-23	394	0.283	0.282	Q0VG66.pdb.gz
8	AFDB:Q6GUA6	0.596	0.532	5.206E-23	444	0.306	0.270	Q6GUA6.pdb.gz	Q6GUA6_PIG Growth/differentiation factor 9 OS=Sus scrofa OX=9823 GN=GDF9 PE=2 SV=1
9	AFDB:Q07105	0.600	0.538	1.314E-22	441	0.306	0.272	Q07105.pdb.gz	GDF9_MOUSE Growth/differentiation factor 9 OS=Mus musculus OX=10090 GN=Gdf9 PE=2 SV=2
10	AFDB:P85857	0.520	0.506	7.800E-21	404	0.232	0.225	P85857.pdb.gz	GDF6A_DANRE Growth/differentiation factor 6-A OS=Danio rerio OX=7955 GN=gdf6a PE=1 SV=1
11	PDB:5vqfB	0.236	0.280	2.388E-9	320	0.186	0.228	5vqfB.pdb.gz
12	PDB:3rjrC	0.202	0.226	1.364E-8	343	0.171	0.195	3rjrC.pdb.gz
13	PDB:5hlyA	0.222	0.282	4.772E-8	299	0.171	0.224	5hlyA.pdb.gz
14	PDB:5ntuA	0.223	0.277	1.343E-7	308	0.156	0.198	5ntuA.pdb.gz
15	PDB:6umxA	0.241	0.316	1.966E-7	279	0.148	0.208	6umxA.pdb.gz
16	PDB:5nxsA	0.255	0.336	4.697E-7	290	0.166	0.224	5nxsA.pdb.gz
17	PDB:5ffoG	0.229	0.283	1.396E-6	297	0.166	0.219	5ffoG.pdb.gz	Force interacts with macromolecular structure in activation of TGF-beta.
18	PDB:7y1rB	0.228	0.276	2.278E-6	308	0.166	0.211	7y1rB.pdb.gz
19	PDB:5nxsB	0.195	0.298	1.875E-4	251	0.143	0.223	5nxsB.pdb.gz
20	PDB:1cqxA	0.131	0.129	8.814E-2	403	0.059	0.057	1cqxA.pdb.gz	Crystal structure of the flavohemoglobin from Alcaligenes eutrophus at 1.75 A resolution.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95972	0.0	815	392	1.000	1.000	BMP15_HUMAN Bone morphogenetic protein 15 OS=Homo sapiens OX=9606 GN=BMP15 PE=1 SV=2
2	Q8WMY6	0.0	586	394	0.737	0.734	Q8WMY6_PIG Bone morphogenetic protein 15 OS=Sus scrofa OX=9823 GN=BMP15 PE=3 SV=2
3	E9PTU9	3.29e-175	495	391	0.638	0.639	E9PTU9_RAT Bone morphogenetic protein 15 OS=Rattus norvegicus OX=10116 GN=Bmp15 PE=3 SV=1
4	Q9WUW1	1.08e-174	494	391	0.635	0.637	Q9WUW1_RAT Growth differentiation factor-9B OS=Rattus norvegicus OX=10116 GN=Bmp15 PE=2 SV=1
5	Q9Z0L4	1.19e-172	489	392	0.638	0.638	BMP15_MOUSE Bone morphogenetic protein 15 OS=Mus musculus OX=10090 GN=Bmp15 PE=2 SV=1
6	Q9QYW4	2.75e-46	166	440	0.319	0.284	Q9QYW4_RAT Growth/differentiation factor 9 OS=Rattus norvegicus OX=10116 GN=Gdf9 PE=3 SV=1
7	O60383	1.85e-45	164	454	0.360	0.311	GDF9_HUMAN Growth/differentiation factor 9 OS=Homo sapiens OX=9606 GN=GDF9 PE=1 SV=1
8	Q6GUA6	4.23e-45	163	444	0.324	0.286	Q6GUA6_PIG Growth/differentiation factor 9 OS=Sus scrofa OX=9823 GN=GDF9 PE=2 SV=1
9	Q9Z0X3	5.80e-45	162	440	0.314	0.280	Q9Z0X3_RAT Growth/differentiation factor 9 OS=Rattus norvegicus OX=10116 GN=Gdf9 PE=2 SV=1
10	Q07105	1.04e-44	162	441	0.319	0.283	GDF9_MOUSE Growth/differentiation factor 9 OS=Mus musculus OX=10090 GN=Gdf9 PE=2 SV=2
11	Q58FS4	3.60e-44	159	384	0.278	0.284	Q58FS4_DANRE Bone morphogenetic protein 15 precursor OS=Danio rerio OX=7955 GN=wu:fi35a05 PE=2 SV=1
12	Q5MD90	2.32e-40	150	418	0.298	0.280	Q5MD90_DANRE Growth and differentiation factor 9 OS=Danio rerio OX=7955 GN=zgc:123030 PE=2 SV=1
13	P43028	3.66e-27	114	454	0.133	0.115	GDF6_MOUSE Growth/differentiation factor 6 OS=Mus musculus OX=10090 GN=Gdf6 PE=2 SV=2
14	Q6KF10	4.96e-27	114	455	0.133	0.114	GDF6_HUMAN Growth/differentiation factor 6 OS=Homo sapiens OX=9606 GN=GDF6 PE=1 SV=1
15	M0RAY4	2.17e-25	109	495	0.296	0.234	M0RAY4_RAT Growth differentiation factor 5 OS=Rattus norvegicus OX=10116 GN=Gdf5 PE=3 SV=1
16	P43026	4.45e-25	108	501	0.273	0.214	GDF5_HUMAN Growth/differentiation factor 5 OS=Homo sapiens OX=9606 GN=GDF5 PE=1 SV=4
17	D4A7P9	6.96e-25	107	454	0.168	0.145	D4A7P9_RAT Bone morphogenetic protein 5 OS=Rattus norvegicus OX=10116 GN=Bmp5 PE=3 SV=3
18	A5HMF9	7.02e-25	107	404	0.161	0.156	A5HMF9_ANAPL Bone morphogenetic protein 4 OS=Anas platyrhynchos OX=8839 GN=BMP4 PE=3 SV=1
19	A5HMF8	7.37e-25	107	404	0.161	0.156	A5HMF8_ANAPL Bone morphogenetic protein 4 OS=Anas platyrhynchos OX=8839 GN=BMP4 PE=2 SV=1
20	Q7Z4P5	8.90e-25	107	450	0.115	0.100	GDF7_HUMAN Growth/differentiation factor 7 OS=Homo sapiens OX=9606 GN=GDF7 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00019 TGF_beta	1e-24	98.7	Transforming growth factor beta like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000252677

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000401907	0.989	Bone morphogenetic protein receptor type-1B
2	9606.ENSP00000363708	0.963	Bone morphogenetic protein receptor type-2
3	9606.ENSP00000310722	0.847	Belongs to the protein kinase superfamily. Ser/Thr protein kinase family
4	9606.ENSP00000333097	0.836	Factor in the germline alpha
5	9606.ENSP00000419457	0.782	Homeobox protein NOBOX
6	9606.ENSP00000319799	0.773	Histone H1oo
7	9606.ENSP00000329803	0.772	Zygote arrest protein 1
8	9606.ENSP00000384708	0.769	Follicle-stimulating hormone receptor
9	9606.ENSP00000221496	0.767	Muellerian-inhibiting factor
10	9606.ENSP00000262753	0.742	Protein POF1B
11	9606.ENSP00000348300	0.731	Protein BTG4
12	9606.ENSP00000294954	0.716	Lutropin-choriogonadotropic hormone receptor
13	9606.ENSP00000243786	0.705	Inhibin alpha chain
14	9606.ENSP00000378326	0.695	Zona pellucida sperm-binding protein 3
15	9606.ENSP00000333188	0.693	Forkhead box protein L2
16	9606.ENSP00000250863	0.643	Deleted in azoospermia-like
17	9606.ENSP00000460971	0.629	Zona pellucida sperm-binding protein 2
18	9606.ENSP00000379683	0.626	Aromatase
19	9606.ENSP00000257863	0.615	Anti-Muellerian hormone type-2 receptor
20	9606.ENSP00000375063	0.600	NACHT, LRR and PYD domains-containing protein 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0048018	1.000	receptor ligand activity
GO:0008083	0.442	growth factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.958	biological regulation
GO:0032501	0.957	multicellular organismal process
GO:0050794	0.946	regulation of cellular process
GO:0009987	0.897	cellular process
GO:0022414	0.847	reproductive process
GO:0032502	0.730	developmental process
GO:0048518	0.714	positive regulation of biological process
GO:0048856	0.637	anatomical structure development
GO:0048522	0.627	positive regulation of cellular process
GO:0019953	0.622	sexual reproduction
GO:0019222	0.596	regulation of metabolic process
GO:0007276	0.527	gamete generation
GO:0060255	0.519	regulation of macromolecule metabolic process
GO:0007292	0.514	female gamete generation
GO:0080090	0.442	regulation of primary metabolic process
GO:0031323	0.431	regulation of cellular metabolic process
GO:0051171	0.423	regulation of nitrogen compound metabolic process
GO:0009893	0.407	positive regulation of metabolic process
GO:0010604	0.402	positive regulation of macromolecule metabolic process
GO:0010468	0.398	regulation of gene expression
GO:0031326	0.377	regulation of cellular biosynthetic process
GO:0010556	0.376	regulation of macromolecule biosynthetic process
GO:0051173	0.372	positive regulation of nitrogen compound metabolic process
GO:0051252	0.372	regulation of RNA metabolic process
GO:0031325	0.370	positive regulation of cellular metabolic process
GO:0006355	0.320	regulation of DNA-templated transcription
GO:0050896	0.307	response to stimulus
GO:0048519	0.301	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0070013	0.955	intracellular organelle lumen
GO:0043231	0.907	intracellular membrane-bounded organelle
GO:0012505	0.873	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]