StarFunc result for job id O95983

User Input

>input (291 residues)
MERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLS
TFDFRTGKMLMSKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPS
NKVKSDPQKAVDQPRQLFWEKKLSGLNAFDIAEELVKTMDLPKGLQGVGPGCTDETLLSA
IASALHTSTMPITGQLSAAVEKNPGVWLNTTQPLCKAFMVTDEDIRKQEELVQQVRKRLE
EALMADMLAHVEELARDGEAPLDKACAEDDDEEDEEEEEEEPDPDPEMEHV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95983	1.000	1.000	3.125E-54	291	1.000	1.000	O95983.pdb.gz	MBD3_HUMAN Methyl-CpG-binding domain protein 3 OS=Homo sapiens OX=9606 GN=MBD3 PE=1 SV=1
2	AFDB:F7EY92	0.493	0.562	3.524E-38	254	0.818	0.937	F7EY92.pdb.gz	F7EY92_RAT Methyl-CpG binding domain protein 3 OS=Rattus norvegicus OX=10116 GN=Mbd3 PE=1 SV=3
3	AFDB:B2RZ64	0.485	0.460	7.590E-38	308	0.814	0.769	B2RZ64.pdb.gz	B2RZ64_RAT Mbd3 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Mbd3 PE=2 SV=1
4	AFDB:Q9Z2E1	0.457	0.328	2.112E-37	414	0.667	0.469	Q9Z2E1.pdb.gz	MBD2_MOUSE Methyl-CpG-binding domain protein 2 OS=Mus musculus OX=10090 GN=Mbd2 PE=1 SV=2
5	AFDB:A0A0R4IA78	0.480	0.524	4.842E-34	265	0.691	0.758	A0A0R4IA78.pdb.gz
6	AFDB:A0A0B4KGZ0	0.368	0.320	1.518E-16	340	0.347	0.297	A0A0B4KGZ0.pdb.gz	A0A0B4KGZ0_DROME Methyl-CpG binding domain protein-like, isoform C OS=Drosophila melanogaster OX=7227 GN=MBD-like PE=1 SV=1
7	AFDB:Q9V424	0.348	0.436	2.089E-15	226	0.282	0.363	Q9V424.pdb.gz	Q9V424_DROME Methyl-CpG binding domain protein-like, isoform B OS=Drosophila melanogaster OX=7227 GN=MBD-like PE=1 SV=1
8	PDB:7ao8C	0.212	0.944	8.344E-10	64	0.165	0.750	7ao8C.pdb.gz	The topology of chromatin-binding domains in the NuRD deacetylase complex.
9	AFDB:A0A024R2B8	0.251	0.242	1.249E-9	302	0.220	0.212	A0A024R2B8.pdb.gz
10	AFDB:Q8WWY6	0.194	0.281	4.208E-9	194	0.282	0.423	Q8WWY6.pdb.gz	MB3L1_HUMAN Methyl-CpG-binding domain protein 3-like 1 OS=Homo sapiens OX=9606 GN=MBD3L1 PE=1 SV=2
11	AFDB:Q9Z2E2	0.240	0.118	1.612E-8	636	0.175	0.080	Q9Z2E2.pdb.gz	MBD1_MOUSE Methyl-CpG-binding domain protein 1 OS=Mus musculus OX=10090 GN=Mbd1 PE=1 SV=2
12	PDB:2z6bA	0.066	0.042	2.986E-1	573	0.103	0.052	2z6bA.pdb.gz
13	PDB:3h0gI	0.108	0.215	5.309E-1	111	0.034	0.090	3h0gI.pdb.gz	Schizosacharomyces pombe RNA polymerase II at 3.6-A resolution.
14	PDB:1g2sA	0.089	0.276	6.432E-1	71	0.041	0.169	1g2sA.pdb.gz
15	PDB:2mgsA	0.083	0.284	8.307E-1	71	0.024	0.099	2mgsA.pdb.gz
16	PDB:1nr4E	0.080	0.235	9.440E-1	69	0.024	0.101	1nr4E.pdb.gz
17	PDB:1f9rA	0.092	0.317	1.073	65	0.024	0.108	1f9rA.pdb.gz
18	PDB:1qe6D	0.091	0.287	1.477	72	0.027	0.111	1qe6D.pdb.gz
19	PDB:5nj2A	0.069	0.073	1.477	272	0.024	0.026	5nj2A.pdb.gz	Phosphate Promotes the Recovery of Mycobacterium tuberculosis beta-Lactamase from Clavulanic Acid Inhibition.
20	PDB:4fl2A	0.076	0.044	1.575	555	0.031	0.016	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95983	0.0	603	291	1.000	1.000	MBD3_HUMAN Methyl-CpG-binding domain protein 3 OS=Homo sapiens OX=9606 GN=MBD3 PE=1 SV=1
2	Q9Z2D8	0.0	547	285	0.897	0.916	MBD3_MOUSE Methyl-CpG-binding domain protein 3 OS=Mus musculus OX=10090 GN=Mbd3 PE=1 SV=1
3	A0A8I6GL26	9.44e-168	467	262	0.773	0.859	A0A8I6GL26_RAT Methyl-CpG binding domain protein 3 OS=Rattus norvegicus OX=10116 GN=Mbd3 PE=1 SV=1
4	A0A8I6ANN7	1.08e-167	466	257	0.773	0.875	A0A8I6ANN7_RAT Methyl-CpG binding domain protein 3 OS=Rattus norvegicus OX=10116 GN=Mbd3 PE=1 SV=1
5	B2RZ64	9.11e-167	466	308	0.773	0.731	B2RZ64_RAT Mbd3 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Mbd3 PE=2 SV=1
6	F7EY92	8.68e-161	450	282	0.773	0.798	F7EY92_RAT Methyl-CpG binding domain protein 3 OS=Rattus norvegicus OX=10116 GN=Mbd3 PE=1 SV=3
7	Q7ZZR0	2.48e-149	419	242	0.691	0.831	Q7ZZR0_DANRE Mbd3b protein OS=Danio rerio OX=7955 GN=mdb3b PE=1 SV=1
8	A0A2R8QPC3	3.24e-148	417	265	0.687	0.755	A0A2R8QPC3_DANRE Methyl-CpG binding domain protein 3b isoform X1 OS=Danio rerio OX=7955 GN=cb357 PE=1 SV=1
9	Q9UBB5	1.58e-142	409	411	0.653	0.462	MBD2_HUMAN Methyl-CpG-binding domain protein 2 OS=Homo sapiens OX=9606 GN=MBD2 PE=1 SV=1
10	Q9Z2E1	7.15e-142	407	414	0.653	0.459	MBD2_MOUSE Methyl-CpG-binding domain protein 2 OS=Mus musculus OX=10090 GN=Mbd2 PE=1 SV=2
11	D4A986	2.65e-141	405	412	0.646	0.456	D4A986_RAT Methyl-CpG binding domain protein 2 OS=Rattus norvegicus OX=10116 GN=Mbd2 PE=1 SV=3
12	B0BNM2	2.86e-141	405	412	0.646	0.456	B0BNM2_RAT Mbd2 protein OS=Rattus norvegicus OX=10116 GN=Mbd2 PE=2 SV=1
13	Q8WWY6	2.12e-44	151	194	0.292	0.438	MB3L1_HUMAN Methyl-CpG-binding domain protein 3-like 1 OS=Homo sapiens OX=9606 GN=MBD3L1 PE=1 SV=2
14	X6RBL6	4.49e-36	131	241	0.210	0.253	X6RBL6_HUMAN Methyl-CpG binding domain protein 2 OS=Homo sapiens OX=9606 GN=MBD2 PE=1 SV=1
15	A0A8I6AFM4	4.89e-36	131	246	0.210	0.248	A0A8I6AFM4_RAT Methyl-CpG binding domain protein 2 OS=Rattus norvegicus OX=10116 GN=Mbd2 PE=1 SV=1
16	Q9V424	2.83e-35	128	226	0.309	0.398	Q9V424_DROME Methyl-CpG binding domain protein-like, isoform B OS=Drosophila melanogaster OX=7227 GN=MBD-like PE=1 SV=1
17	Q9VHB7	6.88e-31	120	339	0.223	0.192	Q9VHB7_DROME LD22928p OS=Drosophila melanogaster OX=7227 GN=MBD-like PE=1 SV=2
18	A0A0B4KGZ0	7.30e-31	120	340	0.223	0.191	A0A0B4KGZ0_DROME Methyl-CpG binding domain protein-like, isoform C OS=Drosophila melanogaster OX=7227 GN=MBD-like PE=1 SV=1
19	Q8NHZ7	3.91e-16	77.4	208	0.186	0.260	MB3L2_HUMAN Methyl-CpG-binding domain protein 3-like 2 OS=Homo sapiens OX=9606 GN=MBD3L2 PE=1 SV=3
20	A6NE82	6.74e-16	76.6	208	0.189	0.264	MB3L3_HUMAN Putative methyl-CpG-binding domain protein 3-like 3 OS=Homo sapiens OX=9606 GN=MBD3L3 PE=5 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01429 MBD	1.2e-19	81.1	Methyl-CpG binding domain
2	PF16564 MBDa	4e-25	99.1	p55-binding region of Methyl-CpG-binding domain proteins MBD
3	PF14048 MBD_C	2.4e-31	119.6	C-terminal domain of methyl-CpG binding protein 2 and 3
4	PF00616 RasGAP	62	14.8	GTPase-activator protein for Ras-like GTPase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000412302

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362649	0.999	Histone deacetylase 1
2	9606.ENSP00000278823	0.998	Metastasis-associated protein MTA2
3	9606.ENSP00000430432	0.998	Histone deacetylase 2
4	9606.ENSP00000349508	0.997	Chromodomain-helicase-DNA-binding protein 4
5	9606.ENSP00000362592	0.996	Histone-binding protein RBBP4
6	9606.ENSP00000369424	0.996	Histone-binding protein RBBP7
7	9606.ENSP00000383973	0.995	Metastasis-associated protein MTA3
8	9606.ENSP00000357644	0.994	Transcriptional repressor p66-beta
9	9606.ENSP00000333633	0.993	Metastasis-associated protein MTA1
10	9606.ENSP00000353463	0.991	Transcriptional repressor p66-alpha
11	9606.ENSP00000369716	0.991	Chromodomain-helicase-DNA-binding protein 3
12	9606.ENSP00000256429	0.975	Methyl-CpG-binding domain protein 2
13	9606.ENSP00000261692	0.936	Cyclin-dependent kinase 2-associated protein 1
14	9606.ENSP00000296417	0.933	Histone H2A.Z
15	9606.ENSP00000380136	0.933	Histone acetyltransferase KAT6A
16	9606.ENSP00000262450	0.927	Chromodomain-helicase-DNA-binding protein 5
17	9606.ENSP00000370800	0.927	methyl-CpG binding domain protein 3 like 2
18	9606.ENSP00000434024	0.927	Histone H2AX
19	9606.ENSP00000358151	0.917	Histone H2B type 2-E
20	9606.ENSP00000365858	0.916	Erythroid transcription factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003682	1.000	chromatin binding
GO:0008327	0.997	methyl-CpG binding
GO:0031490	0.976	chromatin DNA binding
GO:0031491	0.975	nucleosome binding
GO:0031492	0.970	nucleosomal DNA binding
GO:0019899	0.711	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0019222	0.996	regulation of metabolic process
GO:0060255	0.994	regulation of macromolecule metabolic process
GO:0019219	0.993	regulation of nucleobase-containing compound metabolic process
GO:0009987	0.990	cellular process
GO:0071704	0.986	organic substance metabolic process
GO:0044238	0.986	primary metabolic process
GO:0006807	0.985	nitrogen compound metabolic process
GO:0043170	0.984	macromolecule metabolic process
GO:0010468	0.975	regulation of gene expression
GO:0036211	0.966	protein modification process
GO:0032501	0.956	multicellular organismal process
GO:0016570	0.941	histone modification
GO:0007275	0.920	multicellular organism development
GO:0006325	0.918	chromatin organization
GO:0006355	0.899	regulation of DNA-templated transcription
GO:0006338	0.876	chromatin remodeling
GO:0048523	0.872	negative regulation of cellular process
GO:0018193	0.847	peptidyl-amino acid modification
GO:0010605	0.800	negative regulation of macromolecule metabolic process
GO:0006476	0.777	protein deacetylation
GO:0051172	0.773	negative regulation of nitrogen compound metabolic process
GO:0031324	0.769	negative regulation of cellular metabolic process
GO:0018205	0.758	peptidyl-lysine modification
GO:0040029	0.757	epigenetic regulation of gene expression
GO:0009790	0.732	embryo development
GO:0043543	0.725	protein acylation
GO:0045934	0.655	negative regulation of nucleobase-containing compound metabolic process
GO:0006357	0.558	regulation of transcription by RNA polymerase II
GO:0050896	0.547	response to stimulus
GO:0031327	0.540	negative regulation of cellular biosynthetic process
GO:0010558	0.529	negative regulation of macromolecule biosynthetic process
GO:0006473	0.528	protein acetylation
GO:0051253	0.504	negative regulation of RNA metabolic process
GO:0070828	0.500	heterochromatin organization
GO:0000122	0.491	negative regulation of transcription by RNA polymerase II
GO:0048518	0.478	positive regulation of biological process
GO:0016575	0.477	histone deacetylation
GO:0006475	0.340	internal protein amino acid acetylation
GO:0044237	0.327	cellular metabolic process
GO:0048522	0.324	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1902494	1.000	catalytic complex
GO:0000785	1.000	chromatin
GO:0140513	1.000	nuclear protein-containing complex
GO:0005654	1.000	nucleoplasm
GO:0005667	0.995	transcription regulator complex
GO:0000118	0.993	histone deacetylase complex
GO:0005737	0.982	cytoplasm
GO:0070603	0.975	SWI/SNF superfamily-type complex
GO:0016581	0.969	NuRD complex
GO:0000792	0.323	heterochromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]