StarFunc result for job id O95988

User Input

>input (128 residues)
MASEASVRLGVPPGRLWIQRPGIYEDEEGRTWVTVVVRFNPSRREWARASQGSRYEPSIT
VHLWQMAVHTRELLSSGQMPFSQLPAVWQLYPGRKYRAADSSFWEIADHGQIDSMEQLVL
TYQPERKD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95988	1.000	1.000	2.592E-24	128	1.000	1.000	O95988.pdb.gz	TCL1B_HUMAN T-cell leukemia/lymphoma protein 1B OS=Homo sapiens OX=9606 GN=TCL1B PE=1 SV=1
2	AFDB:A0A024R6G5	0.703	0.786	3.408E-9	114	0.266	0.298	A0A024R6G5.pdb.gz
3	AFDB:P56278	0.657	0.780	8.720E-9	107	0.289	0.346	P56278.pdb.gz	MTCP1_HUMAN Protein p13 MTCP-1 OS=Homo sapiens OX=9606 GN=MTCP1 PE=1 SV=1
4	PDB:1qttA	0.644	0.701	1.351E-8	117	0.305	0.333	1qttA.pdb.gz
5	PDB:1jsgA	0.662	0.760	1.508E-8	111	0.266	0.306	1jsgA.pdb.gz
6	AFDB:P56280	0.624	0.684	3.108E-8	116	0.289	0.319	P56280.pdb.gz	TCL1A_MOUSE T-cell leukemia/lymphoma protein 1A OS=Mus musculus OX=10090 GN=Tcl1a PE=1 SV=1
7	PDB:1jnpA	0.654	0.819	1.302E-7	101	0.297	0.376	1jnpA.pdb.gz
8	PDB:5yfgA	0.162	0.118	1.811E-1	186	0.094	0.065	5yfgA.pdb.gz
9	PDB:7c8zA	0.202	0.086	2.667E-1	383	0.141	0.047	7c8zA.pdb.gz	Structural and Biochemical Analysis Reveals a Distinct Catalytic Site of Salicylate 5-Monooxygenase NagGH from Rieske Dioxygenases.
10	PDB:2r55A	0.156	0.107	4.634E-1	208	0.133	0.082	2r55A.pdb.gz
11	AFDB:O06835	0.160	0.138	4.920E-1	170	0.141	0.106	O06835.pdb.gz	STYB_PSEFL NADH-dependent flavin reductase StyB OS=Pseudomonas fluorescens OX=294 GN=styB PE=3 SV=1
12	PDB:2p4bB	0.154	0.091	5.781E-1	260	0.117	0.058	2p4bB.pdb.gz
13	PDB:4uhvB	0.236	0.055	6.109E-1	645	0.094	0.019	4uhvB.pdb.gz
14	PDB:3apxA	0.151	0.130	8.511E-1	179	0.125	0.089	3apxA.pdb.gz	Structural insights into differences in drug-binding selectivity between two forms of human alpha1-acid glycoprotein genetic variants, the A and F1*S forms.
15	PDB:3k87A	0.185	0.157	8.994E-1	164	0.109	0.085	3k87A.pdb.gz	Characterization of chlorophenol 4-monooxygenase (TftD) and NADH:FAD oxidoreductase (TftC) of Burkholderia cepacia AC1100.
16	AFDB:Q8RQP9	0.193	0.162	1.009	176	0.094	0.068	Q8RQP9.pdb.gz	NPHA2_RHOSO NADH-dependent flavin reductase OS=Rhodococcus sp. OX=1831 GN=nphA2 PE=1 SV=2
17	AFDB:Q924P3	0.251	0.199	1.066	175	0.117	0.086	Q924P3.pdb.gz	LCN8_MOUSE Epididymal-specific lipocalin-8 OS=Mus musculus OX=10090 GN=Lcn8 PE=2 SV=1
18	AFDB:G5EC44	0.126	0.080	1.330	267	0.117	0.056	G5EC44.pdb.gz	MRT2_CAEEL Cell cycle checkpoint protein RAD1 homolog mrt-2 OS=Caenorhabditis elegans OX=6239 GN=mrt-2 PE=1 SV=1
19	AFDB:Q9UTQ4	0.168	0.101	1.330	244	0.164	0.086	Q9UTQ4.pdb.gz	YL3B_SCHPO Uncharacterized protein C1071.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1071.11 PE=4 SV=1
20	AFDB:P75893	0.207	0.177	1.406	164	0.102	0.079	P75893.pdb.gz	RUTF_ECOLI FMN reductase (NADH) RutF OS=Escherichia coli (strain K12) OX=83333 GN=rutF PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95988	9.75e-92	262	128	1.000	1.000	TCL1B_HUMAN T-cell leukemia/lymphoma protein 1B OS=Homo sapiens OX=9606 GN=TCL1B PE=1 SV=1
2	Q60945	4.36e-14	65.5	107	0.305	0.364	MTCP1_MOUSE Protein p13 MTCP-1 OS=Mus musculus OX=10090 GN=Mtcp1 PE=2 SV=1
3	P56278	1.77e-13	63.9	107	0.320	0.383	MTCP1_HUMAN Protein p13 MTCP-1 OS=Homo sapiens OX=9606 GN=MTCP1 PE=1 SV=1
4	P56280	2.10e-13	63.9	116	0.312	0.345	TCL1A_MOUSE T-cell leukemia/lymphoma protein 1A OS=Mus musculus OX=10090 GN=Tcl1a PE=1 SV=1
5	P56279	4.44e-09	52.8	114	0.242	0.272	TCL1A_HUMAN T-cell leukemia/lymphoma protein 1A OS=Homo sapiens OX=9606 GN=TCL1A PE=1 SV=1
6	P09172	0.58	32.0	617	0.133	0.028	DOPO_HUMAN Dopamine beta-hydroxylase OS=Homo sapiens OX=9606 GN=DBH PE=1 SV=3
7	G5EB41	1.4	30.8	2132	0.164	0.010	G5EB41_EMENI Adenylate cyclase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cyaA PE=3 SV=1
8	Q96PE1	2.7	30.0	1338	0.188	0.018	AGRA2_HUMAN Adhesion G protein-coupled receptor A2 OS=Homo sapiens OX=9606 GN=ADGRA2 PE=1 SV=2
9	Q91ZV8	3.1	29.6	1336	0.188	0.018	AGRA2_MOUSE Adhesion G protein-coupled receptor A2 OS=Mus musculus OX=10090 GN=Adgra2 PE=1 SV=2
10	B0Y6V5	7.2	28.5	1425	0.141	0.013	B0Y6V5_ASPFC Alpha-aminoadipate reductase OS=Aspergillus fumigatus (strain CBS 144.89 / FGSC A1163 / CEA10) OX=451804 GN=AFUB_068270 PE=3 SV=1
11	P13010	7.6	28.5	732	0.086	0.015	XRCC5_HUMAN X-ray repair cross-complementing protein 5 OS=Homo sapiens OX=9606 GN=XRCC5 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01840 TCL1_MTCP1	1.1e-45	165.3	TCL1/MTCP1 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000343223

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000451828	0.989	RAC-alpha serine/threonine-protein kinase
2	9606.ENSP00000375892	0.930	RAC-beta serine/threonine-protein kinase
3	9606.ENSP00000263826	0.895	RAC-gamma serine/threonine-protein kinase
4	9606.ENSP00000385036	0.845	T-cell leukemia/lymphoma protein 1A
5	9606.ENSP00000358488	0.821	Protein p13 MTCP-1
6	9606.ENSP00000400646	0.713	Polyribonucleotide nucleotidyltransferase 1, mitochondrial
7	9606.ENSP00000422488	0.662	Steroid hormone receptor ERR2
8	9606.ENSP00000342681	0.637	T-cell surface glycoprotein CD5
9	9606.ENSP00000374507	0.632	Protein Daple
10	9606.ENSP00000300651	0.613	Mediator of RNA polymerase II transcription subunit 1
11	9606.ENSP00000478289	0.611	V region of the variable domain of immunoglobulin heavy chains that participates in the antigen recognition . Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins- secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bou [...]
12	9606.ENSP00000229307	0.608	Homeobox protein NANOG
13	9606.ENSP00000257566	0.594	T-box transcription factor TBX3
14	9606.ENSP00000350071	0.578	Striatin-3
15	9606.ENSP00000305976	0.574	Serine/threonine-protein kinase SIK2
16	9606.ENSP00000483570	0.543	Tyrosine-protein kinase BTK
17	9606.ENSP00000259915	0.533	POU domain, class 5, transcription factor 1
18	9606.ENSP00000440428	0.527	C-type lectin domain family 4 member C
19	9606.ENSP00000437940	0.523	B-lymphocyte antigen CD19
20	9606.ENSP00000327890	0.519	Interleukin-3 receptor subunit alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019901	1.000	protein kinase binding
GO:0043539	1.000	protein serine/threonine kinase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.981	regulation of cellular process
GO:0019222	0.966	regulation of metabolic process
GO:0071902	0.959	positive regulation of protein serine/threonine kinase activity
GO:0033138	0.956	positive regulation of peptidyl-serine phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.997	protein-containing complex
GO:0110165	0.885	cellular anatomical entity
GO:0043231	0.795	intracellular membrane-bounded organelle
GO:0016020	0.706	membrane
GO:0005886	0.665	plasma membrane
GO:0005737	0.630	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]