StarFunc result for job id O95990

User Input

>input (144 residues)
MYSEIQRERADIGGLMARPEYREWNPELIKPKKLLNPVKASRSHQELHRELLMNHRRGLG
VDSKPELQRVLEHRRRNQLIKKKKEELEAKRLQCPFEQELLRRQQRLNQLEKPPEKEEDH
APEFIKVRENLRRIATLTSEEREL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R327	0.348	0.294	3.694E-18	175	1.000	0.823	A0A024R327.pdb.gz
2	AFDB:Q3TGF2	0.225	0.247	1.434E-7	131	0.465	0.511	Q3TGF2.pdb.gz	F107B_MOUSE Protein FAM107B OS=Mus musculus OX=10090 GN=Fam107b PE=1 SV=2
3	AFDB:Q9VFL0	0.246	0.087	2.290	588	0.167	0.041	Q9VFL0.pdb.gz	Q9VFL0_DROME IP21508p OS=Drosophila melanogaster OX=7227 GN=IFT54 PE=2 SV=1
4	PDB:7pzyz	0.274	0.225	2.423	179	0.111	0.089	7pzyz.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
5	AFDB:Q6ZUJ8	0.205	0.054	3.503	805	0.118	0.021	Q6ZUJ8.pdb.gz	BCAP_HUMAN Phosphoinositide 3-kinase adapter protein 1 OS=Homo sapiens OX=9606 GN=PIK3AP1 PE=1 SV=2
6	PDB:2y7hB	0.121	0.052	3.980	529	0.097	0.026	2y7hB.pdb.gz	The Structure of M.Ecoki Type I DNA Methyltransferase with a DNA Mimic Antirestriction Protein.
7	AFDB:O74399	0.149	0.043	4.652	740	0.083	0.016	O74399.pdb.gz	ERB1_SCHPO Ribosome biogenesis protein erb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=erb1 PE=1 SV=2
8	AFDB:O96109	0.223	0.128	5.360	334	0.118	0.051	O96109.pdb.gz	O96109_PLAF7 Rifin OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0200200 PE=4 SV=1
9	PDB:6lanA	0.105	0.114	5.673	133	0.028	0.030	6lanA.pdb.gz
10	AFDB:F6TNN0	0.292	0.068	6.630	922	0.146	0.023	F6TNN0.pdb.gz	F6TNN0_CIOIN BZIP domain-containing protein OS=Ciona intestinalis OX=7719 GN=nf-e2 PE=1 SV=2
11	AFDB:O94585	0.185	0.164	6.630	187	0.125	0.096	O94585.pdb.gz	YQ7D_SCHPO Meiotically up-regulated protein C1442.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1442.13c PE=1 SV=3
12	AFDB:P10333	0.297	0.169	6.630	264	0.194	0.106	P10333.pdb.gz	MS2A_DROME Accessory gland-specific peptide 26Aa OS=Drosophila melanogaster OX=7227 GN=Acp26Aa PE=1 SV=2
13	AFDB:Q583E5	0.209	0.143	6.630	260	0.146	0.081	Q583E5.pdb.gz	Q583E5_TRYB2 Large ribosomal subunit protein mL43 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.3I12.430 PE=1 SV=1
14	PDB:7r5jI0	0.238	0.205	7.017	173	0.146	0.121	7r5jI0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
15	PDB:6n7pA	0.169	0.134	8.680	186	0.097	0.075	6n7pA.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
16	PDB:7tveD	0.288	0.101	8.680	445	0.118	0.038	7tveD.pdb.gz	Cryo-EM structure of DNA-bound Smc5/6 reveals DNA clamping enabled by multi-subunit conformational changes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95990	3.58e-99	283	144	1.000	1.000	F107A_HUMAN Actin-associated protein FAM107A OS=Homo sapiens OX=9606 GN=FAM107A PE=1 SV=1
2	Q6IAM1	3.58e-99	283	144	1.000	1.000	Q6IAM1_HUMAN Family with sequence similarity 107 member A transcript variant OS=Homo sapiens OX=9606 GN=TU3A PE=2 SV=1
3	Q78TU8	3.55e-84	244	144	0.910	0.910	F107A_MOUSE Actin-associated protein FAM107A OS=Mus musculus OX=10090 GN=Fam107a PE=1 SV=1
4	M0R3K6	2.80e-71	211	131	0.806	0.885	F107A_RAT Actin-associated protein FAM107A OS=Rattus norvegicus OX=10116 GN=Fam107a PE=3 SV=2
5	Q3TGF2	4.79e-39	130	131	0.507	0.557	F107B_MOUSE Protein FAM107B OS=Mus musculus OX=10090 GN=Fam107b PE=1 SV=2
6	Q8PAI3	0.003	37.4	120	0.132	0.158	Q8PAI3_XANCP Transcriptional regulator gntR family OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=XCC1500 PE=4 SV=1
7	Q20JQ5	0.096	34.7	1932	0.132	0.010	Q20JQ5_DANRE Sodium channel protein OS=Danio rerio OX=7955 GN=scn5Laa PE=2 SV=1
8	P98070	0.88	31.6	707	0.174	0.035	BMP1_XENLA Bone morphogenetic protein 1 OS=Xenopus laevis OX=8355 GN=bmp1 PE=1 SV=1
9	Q5D869	0.98	31.6	1976	0.104	0.008	NRPE1_ARATH DNA-directed RNA polymerase V subunit 1 OS=Arabidopsis thaliana OX=3702 GN=NRPE1 PE=1 SV=1
10	G5EDG4	2.0	30.8	3962	0.118	0.004	G5EDG4_CAEEL Ig-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=him-4 PE=1 SV=2
11	A0A8I6AJD7	6.1	29.3	414	0.194	0.068	A0A8I6AJD7_RAT Histone-lysine N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Suv39h1 PE=3 SV=1
12	A0A8I6A0U8	6.2	29.3	438	0.194	0.064	A0A8I6A0U8_RAT Histone-lysine N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Suv39h1 PE=3 SV=1
13	A0A8I6A3A4	6.2	29.3	445	0.194	0.063	A0A8I6A3A4_RAT Histone-lysine N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Suv39h1 PE=3 SV=1
14	A0A8I5ZJE7	6.4	28.9	286	0.194	0.098	A0A8I5ZJE7_RAT Histone-lysine N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Suv39h1 PE=3 SV=1
15	B1H256	6.6	28.9	412	0.194	0.068	B1H256_RAT Histone-lysine N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Suv39h1 PE=3 SV=1
16	O54864	6.6	28.9	412	0.194	0.068	SUV91_MOUSE Histone-lysine N-methyltransferase SUV39H1 OS=Mus musculus OX=10090 GN=Suv39h1 PE=1 SV=1
17	O74508	9.9	28.5	424	0.167	0.057	SPP1_SCHPO Set1 complex component spp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spp1 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06625 DUF1151	8.7e-36	133.7	Protein of unknown function (DUF1151)
2	PF15369 KIAA1328	1.6e+02	13.4	Uncharacterised protein KIAA1328
3	PF05844 YopD	3.9e+02	11.4	YopD protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000419124

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377047	0.778	Receptor-type tyrosine-protein phosphatase zeta
2	9606.ENSP00000334538	0.682	Splicing regulatory glutamine/lysine-rich protein 1
3	9606.ENSP00000450527	0.678	Homeodomain-only protein
4	9606.ENSP00000399982	0.596	Transcription initiation factor TFIID subunit 6
5	9606.ENSP00000280187	0.580	Neuronal membrane glycoprotein M6-a
6	9606.ENSP00000431512	0.578	Heat shock factor protein 1
7	9606.ENSP00000178640	0.564	Dual specificity mitogen-activated protein kinase kinase 5
8	9606.ENSP00000316527	0.561	Zinc finger protein 609
9	9606.ENSP00000333938	0.556	Nexilin
10	9606.ENSP00000308236	0.551	COMM domain-containing protein 1
11	9606.ENSP00000433560	0.522	Alpha-crystallin B chain
12	9606.ENSP00000366513	0.513	Calsyntenin-1
13	9606.ENSP00000481091	0.506	Transcriptional adapter 2-alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.979	regulation of cellular process
GO:0048519	0.959	negative regulation of biological process
GO:0065008	0.954	regulation of biological quality
GO:0009987	0.953	cellular process
GO:0051171	0.949	regulation of nitrogen compound metabolic process
GO:0060255	0.945	regulation of macromolecule metabolic process
GO:0080090	0.943	regulation of primary metabolic process
GO:0048518	0.900	positive regulation of biological process
GO:0048523	0.821	negative regulation of cellular process
GO:0051246	0.777	regulation of protein metabolic process
GO:1902806	0.769	regulation of cell cycle G1/S phase transition
GO:0032501	0.763	multicellular organismal process
GO:0051173	0.733	positive regulation of nitrogen compound metabolic process
GO:0051128	0.727	regulation of cellular component organization
GO:0010604	0.726	positive regulation of macromolecule metabolic process
GO:0150116	0.705	regulation of cell-substrate junction organization
GO:0010810	0.693	regulation of cell-substrate adhesion
GO:0010812	0.673	negative regulation of cell-substrate adhesion
GO:0001952	0.665	regulation of cell-matrix adhesion
GO:0050896	0.664	response to stimulus
GO:0071840	0.650	cellular component organization or biogenesis
GO:0016043	0.643	cellular component organization
GO:0051247	0.622	positive regulation of protein metabolic process
GO:0022607	0.607	cellular component assembly
GO:1901888	0.605	regulation of cell junction assembly
GO:0051493	0.601	regulation of cytoskeleton organization
GO:0007010	0.595	cytoskeleton organization
GO:0061572	0.588	actin filament bundle organization
GO:0031647	0.576	regulation of protein stability
GO:0048522	0.518	positive regulation of cellular process
GO:0045786	0.503	negative regulation of cell cycle
GO:1903320	0.496	regulation of protein modification by small protein conjugation or removal
GO:2000045	0.479	regulation of G1/S transition of mitotic cell cycle
GO:0051017	0.438	actin filament bundle assembly
GO:0051129	0.429	negative regulation of cellular component organization
GO:1901889	0.348	negative regulation of cell junction assembly
GO:0031398	0.335	positive regulation of protein ubiquitination
GO:0090109	0.324	regulation of cell-substrate junction assembly
GO:1902807	0.321	negative regulation of cell cycle G1/S phase transition
GO:0051893	0.311	regulation of focal adhesion assembly
GO:2000134	0.309	negative regulation of G1/S transition of mitotic cell cycle
GO:0032970	0.308	regulation of actin filament-based process
GO:0007154	0.304	cell communication
GO:0032886	0.301	regulation of microtubule-based process
GO:0032956	0.300	regulation of actin cytoskeleton organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.996	nucleoplasm
GO:0043232	0.992	intracellular non-membrane-bounded organelle
GO:0016607	0.821	nuclear speck
GO:0005737	0.745	cytoplasm
GO:0016020	0.665	membrane
GO:0071944	0.640	cell periphery
GO:0005886	0.632	plasma membrane
GO:0042995	0.596	cell projection
GO:0030054	0.594	cell junction
GO:0005856	0.592	cytoskeleton
GO:0120025	0.587	plasma membrane bounded cell projection
GO:0015629	0.434	actin cytoskeleton
GO:0005829	0.419	cytosol
GO:0043005	0.354	neuron projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]