StarFunc result for job id O95994

User Input

>input (175 residues)
MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEE
ALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSP
DGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O88312	0.760	0.760	1.505E-30	175	0.914	0.914	O88312.pdb.gz	AGR2_MOUSE Anterior gradient protein 2 homolog OS=Mus musculus OX=10090 GN=Agr2 PE=1 SV=1
2	AFDB:Q5RZ65	0.781	0.799	2.229E-26	171	0.657	0.673	Q5RZ65.pdb.gz	AGR2_DANRE Anterior gradient protein 2 homolog OS=Danio rerio OX=7955 GN=agr2 PE=2 SV=1
3	AFDB:Q8TD06	0.720	0.759	1.828E-23	166	0.566	0.596	Q8TD06.pdb.gz	AGR3_HUMAN Anterior gradient protein 3 OS=Homo sapiens OX=9606 GN=AGR3 PE=1 SV=1
4	PDB:3ph9B	0.740	0.955	7.773E-23	135	0.549	0.711	3ph9B.pdb.gz
5	AFDB:F1Q8B0	0.711	0.740	1.710E-22	168	0.503	0.524	F1Q8B0.pdb.gz	F1Q8B0_DANRE Ag1 OS=Danio rerio OX=7955 GN=ag1 PE=1 SV=1
6	AFDB:P55869	0.729	0.691	5.231E-21	185	0.480	0.454	P55869.pdb.gz	AG2_XENLA Anterior gradient protein 2 OS=Xenopus laevis OX=8355 GN=ag2 PE=2 SV=3
7	AFDB:Q503D8	0.682	0.694	9.428E-14	172	0.303	0.308	Q503D8.pdb.gz	Q503D8_DANRE Thioredoxin domain-containing protein 12 OS=Danio rerio OX=7955 GN=TLP19 PE=1 SV=1
8	AFDB:H9D1R1	0.670	0.677	1.148E-13	173	0.309	0.312	H9D1R1.pdb.gz	TXD12_EPICO Thioredoxin domain-containing protein 12 OS=Epinephelus coioides OX=94232 GN=Txndc12 PE=1 SV=1
9	AFDB:O95881	0.677	0.688	1.944E-13	172	0.286	0.291	O95881.pdb.gz	TXD12_HUMAN Thioredoxin domain-containing protein 12 OS=Homo sapiens OX=9606 GN=TXNDC12 PE=1 SV=1
10	AFDB:Q80YT5	0.427	0.112	7.714E-6	790	0.206	0.046	Q80YT5.pdb.gz	SPT20_MOUSE Spermatogenesis-associated protein 20 OS=Mus musculus OX=10090 GN=Spata20 PE=1 SV=1
11	AFDB:P36655	0.474	0.167	2.210E-5	565	0.183	0.057	P36655.pdb.gz	DSBD_ECOLI Thiol:disulfide interchange protein DsbD OS=Escherichia coli (strain K12) OX=83333 GN=dsbD PE=1 SV=4
12	PDB:3qouA	0.372	0.246	1.305E-3	282	0.103	0.064	3qouA.pdb.gz	Escherichia coli Thioredoxin-like Protein YbbN Contains an Atypical Tetratricopeptide Repeat Motif and Is a Negative Regulator of GroEL.
13	PDB:1wmjA	0.376	0.492	1.937E-3	122	0.097	0.139	1wmjA.pdb.gz
14	PDB:1xflA	0.406	0.580	2.359E-3	114	0.114	0.175	1xflA.pdb.gz
15	PDB:3ed3A	0.424	0.296	3.070E-3	267	0.114	0.075	3ed3A.pdb.gz
16	PDB:4j56E	0.356	0.543	3.278E-3	105	0.051	0.086	4j56E.pdb.gz	Crystal Structure of the Plasmodium falciparum Thioredoxin Reductase-Thioredoxin Complex.
17	PDB:2l4qA	0.404	0.562	3.739E-3	116	0.103	0.155	2l4qA.pdb.gz
18	PDB:6z7oA	0.439	0.642	5.548E-3	110	0.097	0.155	6z7oA.pdb.gz	Structures of the germline-specific Deadhead and thioredoxin T proteins from Drosophila melanogaster reveal unique features among thioredoxins.
19	PDB:4ekzA	0.368	0.158	5.926E-3	469	0.143	0.053	4ekzA.pdb.gz
20	PDB:3f3qA	0.319	0.467	6.329E-3	109	0.080	0.128	3f3qA.pdb.gz	Structural and kinetic analysis of Saccharomyces cerevisiae thioredoxin Trx1: implications for the catalytic mechanism of GSSG reduced by the thioredoxin system

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95994	1.50e-128	359	175	1.000	1.000	AGR2_HUMAN Anterior gradient protein 2 homolog OS=Homo sapiens OX=9606 GN=AGR2 PE=1 SV=1
2	O88312	1.61e-117	332	175	0.914	0.914	AGR2_MOUSE Anterior gradient protein 2 homolog OS=Mus musculus OX=10090 GN=Agr2 PE=1 SV=1
3	Q5RZ65	2.66e-83	245	171	0.703	0.719	AGR2_DANRE Anterior gradient protein 2 homolog OS=Danio rerio OX=7955 GN=agr2 PE=2 SV=1
4	Q8TD06	6.64e-74	221	166	0.617	0.651	AGR3_HUMAN Anterior gradient protein 3 OS=Homo sapiens OX=9606 GN=AGR3 PE=1 SV=1
5	B5MC62	2.07e-65	199	163	0.560	0.601	B5MC62_HUMAN Anterior gradient 3, protein disulphide isomerase family member OS=Homo sapiens OX=9606 GN=AGR3 PE=1 SV=1
6	F1Q8B0	1.54e-63	194	168	0.514	0.536	F1Q8B0_DANRE Ag1 OS=Danio rerio OX=7955 GN=ag1 PE=1 SV=1
7	H7C040	2.09e-59	183	129	0.463	0.628	H7C040_HUMAN Anterior gradient 3, protein disulphide isomerase family member (Fragment) OS=Homo sapiens OX=9606 GN=AGR3 PE=1 SV=1
8	P55869	8.54e-57	178	185	0.486	0.459	AG2_XENLA Anterior gradient protein 2 OS=Xenopus laevis OX=8355 GN=ag2 PE=2 SV=3
9	Q503D8	5.47e-24	94.4	172	0.286	0.291	Q503D8_DANRE Thioredoxin domain-containing protein 12 OS=Danio rerio OX=7955 GN=TLP19 PE=1 SV=1
10	H9D1R1	7.91e-24	94.0	173	0.280	0.283	TXD12_EPICO Thioredoxin domain-containing protein 12 OS=Epinephelus coioides OX=94232 GN=Txndc12 PE=1 SV=1
11	Q9CQU0	3.74e-22	89.4	170	0.286	0.294	TXD12_MOUSE Thioredoxin domain-containing protein 12 OS=Mus musculus OX=10090 GN=Txndc12 PE=1 SV=1
12	Q498E0	4.39e-22	89.4	170	0.280	0.288	TXD12_RAT Thioredoxin domain-containing protein 12 OS=Rattus norvegicus OX=10116 GN=Txndc12 PE=2 SV=2
13	O95881	4.84e-21	86.7	172	0.280	0.285	TXD12_HUMAN Thioredoxin domain-containing protein 12 OS=Homo sapiens OX=9606 GN=TXNDC12 PE=1 SV=1
14	Q57WA5	0.41	33.1	548	0.114	0.036	Q57WA5_TRYB2 Flagellar radial spoke protein-like, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.28C22.890 PE=4 SV=1
15	Q02440	1.3	32.0	1829	0.154	0.015	MYO5A_CHICK Unconventional myosin-Va OS=Gallus gallus OX=9031 GN=MYO5A PE=1 SV=1
16	Q80YT5	6.6	29.6	790	0.097	0.022	SPT20_MOUSE Spermatogenesis-associated protein 20 OS=Mus musculus OX=10090 GN=Spata20 PE=1 SV=1
17	Q99104	7.2	29.6	1853	0.154	0.015	MYO5A_MOUSE Unconventional myosin-Va OS=Mus musculus OX=10090 GN=Myo5a PE=1 SV=2
18	A0A1D8PP39	7.4	29.6	582	0.069	0.021	A0A1D8PP39_CANAL Glycosyl hydrolase family 13 catalytic domain-containing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C504940WA PE=4 SV=1
19	Q9QYF3	7.6	29.6	1828	0.154	0.015	MYO5A_RAT Unconventional myosin-Va OS=Rattus norvegicus OX=10116 GN=Myo5a PE=1 SV=1
20	P28789	9.6	28.9	327	0.069	0.037	HEM3_YEAST Porphobilinogen deaminase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HEM3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11009 DUF2847	3.9e+02	12.3	Protein of unknown function (DUF2847)
2	PF13098 Thioredoxin_2	30	16.5	Thioredoxin-like domain
3	PF13899 Thioredoxin_7	1.6e-19	81.2	Thioredoxin-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000391490

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000244333	0.988	Ly6/PLAUR domain-containing protein 3
2	9606.ENSP00000473172	0.964	RuvB-like 2
3	9606.ENSP00000442600	0.888	Dystroglycan
4	9606.ENSP00000327801	0.843	Protein disulfide-isomerase
5	9606.ENSP00000250448	0.801	Hepatocyte nuclear factor 3-alpha
6	9606.ENSP00000291527	0.769	Trefoil factor 1
7	9606.ENSP00000324173	0.767	78 kDa glucose-regulated protein
8	9606.ENSP00000308606	0.766	Anterior gradient protein 3
9	9606.ENSP00000430690	0.764	Trefoil factor 3
10	9606.ENSP00000363149	0.724	SAM pointed domain-containing Ets transcription factor
11	9606.ENSP00000485659	0.648	Mucin-5AC
12	9606.ENSP00000378577	0.643	Claudin-3
13	9606.ENSP00000300289	0.636	Protein disulfide-isomerase A3
14	9606.ENSP00000449404	0.631	Keratin, type II cytoskeletal 8
15	9606.ENSP00000358820	0.621	Epidermal growth factor receptor kinase substrate 8-like protein 3
16	9606.ENSP00000436812	0.614	Mucin-5B
17	9606.ENSP00000286091	0.604	Protein disulfide-isomerase A4
18	9606.ENSP00000352673	0.592	ETS-related transcription factor Elf-3
19	9606.ENSP00000405330	0.589	Estrogen receptor
20	9606.ENSP00000343657	0.579	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0002162	0.644	dystroglycan binding
GO:0003824	0.612	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0009987	0.977	cellular process
GO:0048518	0.960	positive regulation of biological process
GO:0050794	0.948	regulation of cellular process
GO:0050896	0.890	response to stimulus
GO:0010646	0.841	regulation of cell communication
GO:0032502	0.835	developmental process
GO:0023051	0.835	regulation of signaling
GO:1905897	0.833	regulation of response to endoplasmic reticulum stress
GO:0009966	0.827	regulation of signal transduction
GO:0048522	0.826	positive regulation of cellular process
GO:0048519	0.810	negative regulation of biological process
GO:0048856	0.806	anatomical structure development
GO:1903829	0.798	positive regulation of protein localization
GO:1904375	0.780	regulation of protein localization to cell periphery
GO:0032501	0.771	multicellular organismal process
GO:1905475	0.748	regulation of protein localization to membrane
GO:1900101	0.747	regulation of endoplasmic reticulum unfolded protein response
GO:1901184	0.727	regulation of ERBB signaling pathway
GO:0019222	0.702	regulation of metabolic process
GO:0030155	0.690	regulation of cell adhesion
GO:1904377	0.690	positive regulation of protein localization to cell periphery
GO:0048584	0.656	positive regulation of response to stimulus
GO:0048523	0.641	negative regulation of cellular process
GO:0042058	0.627	regulation of epidermal growth factor receptor signaling pathway
GO:1903078	0.627	positive regulation of protein localization to plasma membrane
GO:0009967	0.591	positive regulation of signal transduction
GO:0030154	0.586	cell differentiation
GO:0007275	0.546	multicellular organism development
GO:0060255	0.537	regulation of macromolecule metabolic process
GO:0051179	0.461	localization
GO:1905898	0.453	positive regulation of response to endoplasmic reticulum stress
GO:1901186	0.451	positive regulation of ERBB signaling pathway
GO:0002065	0.440	columnar/cuboidal epithelial cell differentiation
GO:0048513	0.426	animal organ development
GO:0048565	0.417	digestive tract development
GO:0045742	0.415	positive regulation of epidermal growth factor receptor signaling pathway
GO:0009893	0.398	positive regulation of metabolic process
GO:0031323	0.389	regulation of cellular metabolic process
GO:0080090	0.379	regulation of primary metabolic process
GO:0051171	0.336	regulation of nitrogen compound metabolic process
GO:0010468	0.330	regulation of gene expression
GO:0010604	0.312	positive regulation of macromolecule metabolic process
GO:0008152	0.310	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	0.999	endoplasmic reticulum
GO:0005576	0.995	extracellular region
GO:0005615	0.958	extracellular space
GO:0016020	0.525	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]