StarFunc result for job id O95995

User Input

>input (478 residues)
MAPKKKGKKGKAKGTPIVDGLAPEDMSKEQVEEHVSRIREELDREREERNYFQLERDKIH
TFWEITRRQLEEKKAELRNKDREMEEAEERHQVEIKVYKQKVKHLLYEHQNNLTEMKAEG
TVVMKLAQKEHRIQESVLRKDMRALKVELKEQELASEVVVKNLRLKHTEEITRMRNDFER
QVREIEAKYDKKMKMLRDELDLRRKTELHEVEERKNGQIHTLMQRHEEAFTDIKNYYNDI
TLNNLALINSLKEQMEDMRKKEDHLEREMAEVSGQNKRLADPLQKAREEMSEMQKQLANY
ERDKQILLCTKARLKVREKELKDLQWEHEVLEQRFTKVQQERDELYRKFTAAIQEVQQKT
GFKNLVLERKLQALSAAVEKKEVQFNEVLAASNLDPAALTLVSRKLEDVLESKNSTIKDL
QYELAQVCKAHNDLLRTYEAKLLAFGIPLDNVGFKPLETAVIGQTLGQGPAGLVGTPT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A384MR00	0.428	0.428	2.543E-55	478	1.000	1.000	A0A384MR00.pdb.gz	A0A384MR00_HUMAN Dynein regulatory complex subunit 4 OS=Homo sapiens OX=9606 PE=2 SV=1
2	AFDB:F1QNW4	0.530	0.532	1.502E-34	475	0.638	0.642	F1QNW4.pdb.gz	DRC4_DANRE Dynein regulatory complex subunit 4 OS=Danio rerio OX=7955 GN=gas8 PE=2 SV=1
3	AFDB:Q7XJ96	0.436	0.443	1.098E-31	471	0.552	0.561	Q7XJ96.pdb.gz	DRC4_CHLRE Dynein regulatory complex subunit 4 OS=Chlamydomonas reinhardtii OX=3055 GN=DRC4 PE=1 SV=1
4	AFDB:Q38CZ5	0.469	0.483	9.649E-18	461	0.347	0.360	Q38CZ5.pdb.gz	Q38CZ5_TRYB2 Trypanin-related protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.244.2800 PE=3 SV=1
5	AFDB:O15697	0.441	0.459	1.933E-16	453	0.316	0.333	O15697.pdb.gz	DRC4_TRYBR Trypanin OS=Trypanosoma brucei rhodesiense OX=31286 PE=2 SV=1
6	AFDB:P87169	0.266	0.202	6.438E-2	689	0.195	0.135	P87169.pdb.gz	MAD1_SCHPO Spindle assembly checkpoint component mad1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mad1 PE=1 SV=1
7	AFDB:A0JNT9	0.234	0.198	3.404E-1	577	0.165	0.137	A0JNT9.pdb.gz	BICL1_MOUSE BICD family-like cargo adapter 1 OS=Mus musculus OX=10090 GN=Bicdl1 PE=1 SV=1
8	AFDB:Q96JN2	0.191	0.098	4.749E-1	1154	0.165	0.068	Q96JN2.pdb.gz	CC136_HUMAN Coiled-coil domain-containing protein 136 OS=Homo sapiens OX=9606 GN=CCDC136 PE=1 SV=3
9	AFDB:P40957	0.284	0.191	9.883E-1	749	0.146	0.093	P40957.pdb.gz	MAD1_YEAST Spindle assembly checkpoint component MAD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MAD1 PE=1 SV=1
10	AFDB:Q1ZXL0	0.188	0.113	1.379	808	0.109	0.064	Q1ZXL0.pdb.gz	Y5795_DICDI PH domain-containing protein DDB_G0275795 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0275795 PE=4 SV=1
11	PDB:7nacI	0.056	0.051	6.888	533	0.023	0.021	7nacI.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
12	PDB:3wqyA	0.087	0.049	8.411	905	0.023	0.012	3wqyA.pdb.gz	The selective tRNA aminoacylation mechanism based on a single G.U pair

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WZT7	0.0	795	395	0.826	1.000	A0A087WZT7_HUMAN Dynein regulatory complex subunit 4 OS=Homo sapiens OX=9606 GN=GAS8 PE=1 SV=1
2	A0A384MR00	0.0	964	478	1.000	1.000	A0A384MR00_HUMAN Dynein regulatory complex subunit 4 OS=Homo sapiens OX=9606 PE=2 SV=1
3	F1QNW4	0.0	547	475	0.640	0.644	DRC4_DANRE Dynein regulatory complex subunit 4 OS=Danio rerio OX=7955 GN=gas8 PE=2 SV=1
4	O95995	0.0	964	478	1.000	1.000	DRC4_HUMAN Dynein regulatory complex subunit 4 OS=Homo sapiens OX=9606 GN=GAS8 PE=1 SV=1
5	Q60779	0.0	828	478	0.908	0.908	DRC4_MOUSE Dynein regulatory complex subunit 4 OS=Mus musculus OX=10090 GN=Gas8 PE=1 SV=2
6	Q7XJ96	2.70e-170	489	471	0.540	0.548	DRC4_CHLRE Dynein regulatory complex subunit 4 OS=Chlamydomonas reinhardtii OX=3055 GN=DRC4 PE=1 SV=1
7	Q38CZ5	2.46e-90	285	461	0.333	0.345	Q38CZ5_TRYB2 Trypanin-related protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.244.2800 PE=3 SV=1
8	O15697	8.91e-71	233	453	0.316	0.333	DRC4_TRYBR Trypanin OS=Trypanosoma brucei rhodesiense OX=31286 PE=2 SV=1
9	O95153	1.01e-04	47.8	1857	0.100	0.026	RIMB1_HUMAN Peripheral-type benzodiazepine receptor-associated protein 1 OS=Homo sapiens OX=9606 GN=TSPOAP1 PE=1 SV=2
10	Q54HI5	0.003	42.7	716	0.117	0.078	LMNB1_DICDI Lamin-like protein OS=Dictyostelium discoideum OX=44689 GN=lmnB PE=1 SV=1
11	Q9Y7S2	0.017	39.7	375	0.115	0.147	YQO3_SCHPO UPF0612 protein C569.003 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC569.03 PE=3 SV=2
12	A6QLN6	0.21	37.0	1972	0.188	0.046	A6QLN6_BOVIN MYH11 protein OS=Bos taurus OX=9913 GN=MYH11 PE=1 SV=1
13	A0A2P9DU05	1.1	34.3	1388	0.098	0.034	A0A2P9DU05_HUMAN Rho-associated protein kinase OS=Homo sapiens OX=9606 GN=ROCK2 PE=2 SV=1
14	E9PF63	1.1	34.3	1145	0.096	0.040	E9PF63_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=ROCK2 PE=1 SV=1
15	O75116	1.1	34.3	1388	0.098	0.034	ROCK2_HUMAN Rho-associated protein kinase 2 OS=Homo sapiens OX=9606 GN=ROCK2 PE=1 SV=4
16	P70336	1.5	33.9	1388	0.098	0.034	ROCK2_MOUSE Rho-associated protein kinase 2 OS=Mus musculus OX=10090 GN=Rock2 PE=1 SV=1
17	Q3UU96	2.1	33.5	1719	0.067	0.019	MRCKA_MOUSE Serine/threonine-protein kinase MRCK alpha OS=Mus musculus OX=10090 GN=Cdc42bpa PE=1 SV=2
18	Q382P4	2.2	33.5	1299	0.103	0.038	Q382P4_TRYB2 IF rod domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.52.0008 PE=4 SV=1
19	P23731	2.8	33.1	589	0.086	0.070	IFEB_ASCSU Intermediate filament protein B OS=Ascaris suum OX=6253 PE=1 SV=1
20	O54874	3.1	33.1	1732	0.063	0.017	MRCKA_RAT Serine/threonine-protein kinase MRCK alpha OS=Rattus norvegicus OX=10116 GN=Cdc42bpa PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10157 BORCS6	2.8e+02	13.1	BLOC-1-related complex sub-unit 6 C-terminal helix
2	PF13851 GAS	1.9e-77	270.7	Growth-arrest specific micro-tubule binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000268699

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000415786	0.937	Glia-derived nexin
2	9606.ENSP00000312706	0.931	Coiled-coil domain-containing protein 65
3	9606.ENSP00000249373	0.904	Smoothened homolog
4	9606.ENSP00000353942	0.887	Dynein regulatory complex subunit 7
5	9606.ENSP00000380679	0.868	Coiled-coil domain-containing protein 40
6	9606.ENSP00000296218	0.849	Axonemal dynein light intermediate polypeptide 1
7	9606.ENSP00000405708	0.843	Coiled-coil domain-containing protein 39
8	9606.ENSP00000288710	0.814	Dynein regulatory complex protein 1
9	9606.ENSP00000360718	0.809	Ras-related protein Rab-3B
10	9606.ENSP00000318429	0.758	Coiled-coil domain-containing protein 114
11	9606.ENSP00000252655	0.757	Radial spoke head protein 3 homolog
12	9606.ENSP00000291536	0.728	Radial spoke head 1 homolog
13	9606.ENSP00000229554	0.719	Radial spoke head protein 4 homolog A
14	9606.ENSP00000263346	0.718	Transcription factor 25
15	9606.ENSP00000407213	0.717	IQ motif containing with AAA domain 1
16	9606.ENSP00000360560	0.710	T-complex-associated-testis-expressed 1
17	9606.ENSP00000415836	0.705	Zinc finger protein 276
18	9606.ENSP00000265104	0.677	Dynein heavy chain 5, axonemal
19	9606.ENSP00000348757	0.674	Coiled-coil domain-containing protein 151
20	9606.ENSP00000361238	0.673	Radial spoke head 9 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070925	0.997	organelle assembly
GO:0044782	0.997	cilium organization
GO:0001578	0.997	microtubule bundle formation
GO:0120031	0.997	plasma membrane bounded cell projection assembly
GO:0003341	0.986	cilium movement
GO:0035082	0.986	axoneme assembly
GO:0050794	0.971	regulation of cellular process
GO:0001539	0.957	cilium or flagellum-dependent cell motility
GO:0060285	0.948	cilium-dependent cell motility
GO:0060294	0.874	cilium movement involved in cell motility
GO:0060341	0.747	regulation of cellular localization
GO:0048518	0.667	positive regulation of biological process
GO:0032880	0.517	regulation of protein localization
GO:0048522	0.424	positive regulation of cellular process
GO:1903829	0.393	positive regulation of protein localization
GO:0032502	0.362	developmental process
GO:0032501	0.343	multicellular organismal process
GO:0048856	0.328	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.993	cytosol
GO:0043226	0.991	organelle
GO:0005886	0.985	plasma membrane
GO:0043227	0.980	membrane-bounded organelle
GO:0043229	0.978	intracellular organelle
GO:0043232	0.973	intracellular non-membrane-bounded organelle
GO:0005929	0.912	cilium
GO:0005856	0.886	cytoskeleton
GO:0031514	0.683	motile cilium
GO:0015630	0.651	microtubule cytoskeleton
GO:0043231	0.600	intracellular membrane-bounded organelle
GO:0005930	0.477	axoneme

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]