StarFunc result for job id O95996

User Input

>input (2303 residues)
MASSVAPYEQLVRQVEALKAENSHLRQELRDNSSHLSKLETETSGMKEVLKHLQGKLEQE
ARVLVSSGQTEVLEQLKALQMDITSLYNLKFQPPTLGPEPAARTPEGSPVHGSGPSKDSF
GELSRATIRLLEELDRERCFLLNEIEKEEKEKLWYYSQLQGLSKRLDELPHVETQFSMQM
DLIRQQLEFEAQHIRSLMEERFGTSDEMVQRAQIRASRLEQIDKELLEAQDRVQQTEPQA
LLAVKSVPVDEDPETEVPTHPEDGTPQPGNSKVEVVFWLLSMLATRDQEDTARTLLAMSS
SPESCVAMRRSGCLPLLLQILHGTEAAAGGRAGAPGAPGAKDARMRANAALHNIVFSQPD
QGLARKEMRVLHVLEQIRAYCETCWDWLQARDGGPEGGGAGSAPIPIEPQICQATCAVMK
LSFDEEYRRAMNELGGLQAVAELLQVDYEMHKMTRDPLNLALRRYAGMTLTNLTFGDVAN
KATLCARRGCMEAIVAQLASDSEELHQVVSSILRNLSWRADINSKKVLREAGSVTALVQC
VLRATKESTLKSVLSALWNLSAHSTENKAAICQVDGALGFLVSTLTYKCQSNSLAIIESG
GGILRNVSSLVATREDYRQVLRDHNCLQTLLQHLTSHSLTIVSNACGTLWNLSARSARDQ
ELLWDLGAVGMLRNLVHSKHKMIAMGSAAALRNLLAHRPAKHQAAATAVSPGSCVPSLYV
RKQRALEAELDARHLAQALEHLEKQGPPAAEAATKKPLPPLRHLDGLAQDYASDSGCFDD
DDAPSSLAAAAATGEPASPAALSLFLGSPFLQGQALARTPPTRRGGKEAEKDTSGEAAVA
AKAKAKLALAVARIDQLVEDISALHTSSDDSFSLSSGDPGQEAPREGRAQSCSPCRGPEG
GRREAGSRAHPLLRLKAAHASLSNDSLNSGSASDGYCPREHMLPCPLAALASRREDPRCG
QPRPSRLDLDLPGCQAEPPAREATSADARVRTIKLSPTYQHVPLLEGASRAGAEPLAGPG
ISPGARKQAWLPADHLSKVPEKLAAAPLSVASKALQKLAAQEGPLSLSRCSSLSSLSSAG
RPGPSEGGDLDDSDSSLEGLEEAGPSEAELDSTWRAPGATSLPVAIPAPRRNRGRGLGVE
DATPSSSSENYVQETPLVLSRCSSVSSLGSFESPSIASSIPSEPCSGQGSGTISPSELPD
SPGQTMPPSRSKTPPLAPAPQGPPEATQFSLQWESYVKRFLDIADCRERCRLPSELDAGS
VRFTVEKPDENFSCASSLSALALHEHYVQQDVELRLLPSACPERGGGAGGAGLHFAGHRR
REEGPAPTGSRPRGAADQELELLRECLGAAVPARLRKVASALVPGRRALPVPVYMLVPAP
APAQEDDSCTDSAEGTPVNFSSAASLSDETLQGPPRDQPGGPAGRQRPTGRPTSARQAMG
HRHKAGGAGRSAEQSRGAGKNRAGLELPLGRPPSAPADKDGSKPGRTRGDGALQSLCLTT
PTEEAVYCFYGNDSDEEPPAAAPTPTHRRTSAIPRAFTRERPQGRKEAPAPSKAAPAAPP
PARTQPSLIADETPPCYSLSSSASSLSEPEPSEPPAVHPRGREPAVTKDPGPGGGRDSSP
SPRAAEELLQRCISSALPRRRPPVSGLRRRKPRATRLDERPAEGSRERGEEAAGSDRASD
LDSVEWRAIQEGANSIVTWLHQAAAATREASSESDSILSFVSGLSVGSTLQPPKHRKGRQ
AEGEMGSARRPEKRGAASVKTSGSPRSPAGPEKPRGTQKTTPGVPAVLRGRTVIYVPSPA
PRAQPKGTPGPRATPRKVAPPCLAQPAAPAKVPSPGQQRSRSLHRPAKTSELATLSQPPR
SATPPARLAKTPSSSSSQTSPASQPLPRKRPPVTQAAGALPGPGASPVPKTPARTLLAKQ
HKTQRSPVRIPFMQRPARRGPPPLARAVPEPGPRGRAGTEAGPGARGGRLGLVRVASALS
SGSESSDRSGFRRQLTFIKESPGLRRRRSELSSAESAASAPQGASPRRGRPALPAVFLCS
SRCEELRAAPRQGPAPARQRPPAARPSPGERPARRTTSESPSRLPVRAPAARPETVKRYA
SLPHISVARRPDGAVPAAPASADAARRSSDGEPRPLPRVAAPGTTWRRIRDEDVPHILRS
TLPATALPLRGSTPEDAPAGPPPRKTSDAVVQTEEVAAPKTNSSTSPSLETREPPGAPAG
GQLSLLGSDVDGPSLAKAPISAPFVHEGLGVAVGGFPASRHGSPSRSARVPPFNYVPSPM
VVAATTDSAAEKAPATASATLLE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2JZW4	0.398	0.397	0.000	2308	0.816	0.814	A0A0G2JZW4.pdb.gz	A0A0G2JZW4_RAT APC regulator of WNT signaling pathway 2 OS=Rattus norvegicus OX=10116 GN=Apc2 PE=3 SV=2
2	AFDB:O95996	0.999	0.999	0.000	2303	1.000	1.000	O95996.pdb.gz	APCL_HUMAN Adenomatous polyposis coli protein 2 OS=Homo sapiens OX=9606 GN=APC2 PE=1 SV=1
3	AFDB:Q9VAS9	0.190	0.181	1.415E-44	2417	0.224	0.214	Q9VAS9.pdb.gz	Q9VAS9_DROME APC-like, isoform A OS=Drosophila melanogaster OX=7227 GN=Apc PE=3 SV=1
4	AFDB:Q21227	0.150	0.277	6.422E-23	1188	0.107	0.207	Q21227.pdb.gz	APR1_CAEEL Adenomatous polyposis coli protein-related protein 1 OS=Caenorhabditis elegans OX=6239 GN=apr-1 PE=1 SV=2
5	PDB:2z6gA	0.104	0.334	3.813E-10	550	0.042	0.176	2z6gA.pdb.gz
6	AFDB:F4J8G7	0.110	0.116	2.015E-9	2138	0.082	0.088	F4J8G7.pdb.gz	VIR_ARATH Protein virilizer homolog OS=Arabidopsis thaliana OX=3702 GN=VIR PE=1 SV=1
7	PDB:5tbkA	0.115	0.539	6.430E-9	417	0.030	0.165	5tbkA.pdb.gz
8	PDB:4tnmA	0.110	0.508	2.469E-8	407	0.027	0.155	4tnmA.pdb.gz
9	AFDB:Q6PR54	0.096	0.093	2.840E-8	2419	0.124	0.118	Q6PR54.pdb.gz	RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus OX=10090 GN=Rif1 PE=1 SV=2
10	AFDB:A1Z6M0	0.080	0.095	6.366E-8	1688	0.099	0.134	A1Z6M0.pdb.gz	A1Z6M0_DROME Brahma associated protein 170kD OS=Drosophila melanogaster OX=7227 GN=Bap170 PE=1 SV=1
11	PDB:1wa5B	0.106	0.443	6.925E-8	466	0.030	0.148	1wa5B.pdb.gz	Structural basis for the assembly of a nuclear export complex.
12	PDB:4r0zA	0.101	0.370	7.243E-8	557	0.034	0.142	4r0zA.pdb.gz
13	AFDB:P29539	0.041	0.046	7.282E-8	1916	0.066	0.079	P29539.pdb.gz	RIF1_YEAST Telomere length regulator protein RIF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RIF1 PE=1 SV=3
14	PDB:7nscE	0.091	0.279	9.063E-8	615	0.040	0.150	7nscE.pdb.gz
15	PDB:6kbnC	0.115	0.473	1.084E-7	504	0.036	0.165	6kbnC.pdb.gz	Quaternary structures of Vac8 differentially regulate the Cvt and PMN pathways.
16	AFDB:Q8WYP5	0.070	0.071	1.140E-7	2266	0.115	0.117	Q8WYP5.pdb.gz	ELYS_HUMAN Protein ELYS OS=Homo sapiens OX=9606 GN=AHCTF1 PE=1 SV=3
17	AFDB:Q5UIP0	0.076	0.073	1.632E-7	2472	0.126	0.117	Q5UIP0.pdb.gz	RIF1_HUMAN Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2
18	PDB:3tpoA	0.104	0.447	2.324E-7	438	0.033	0.176	3tpoA.pdb.gz
19	PDB:7rroH7	0.108	0.377	3.181E-7	580	0.032	0.128	7rroH7.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
20	PDB:6swy5	0.121	0.309	3.276E-6	789	0.021	0.062	6swy5.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0C4DGQ0	0.0	1461	702	0.305	1.000	A0A0C4DGQ0_HUMAN Adenomatous polyposis coli protein 2 (Fragment) OS=Homo sapiens OX=9606 GN=APC2 PE=1 SV=1
2	A0A0D9RR03	0.0	918	2861	0.218	0.176	A0A0D9RR03_CHLSB APC regulator of WNT signaling pathway OS=Chlorocebus sabaeus OX=60711 GN=APC PE=3 SV=1
3	A0A0G2JZW4	0.0	3348	2281	0.818	0.826	A0A0G2JZW4_RAT APC regulator of WNT signaling pathway 2 OS=Rattus norvegicus OX=10116 GN=Apc2 PE=3 SV=2
4	A0A0R4IWH7	0.0	868	2754	0.213	0.178	A0A0R4IWH7_DANRE APC regulator of WNT-signaling pathway OS=Danio rerio OX=7955 GN=cb965 PE=1 SV=1
5	A0A2Q2SV78	0.0	843	1135	0.206	0.418	A0A2Q2SV78_HUMAN APC regulator of WNT signaling pathway (Fragment) OS=Homo sapiens OX=9606 GN=APC PE=1 SV=1
6	D4A205	0.0	3339	2304	0.818	0.817	D4A205_RAT APC regulator of WNT signaling pathway 2 OS=Rattus norvegicus OX=10116 GN=Apc2 PE=3 SV=2
7	E9PFT7	0.0	917	1304	0.220	0.389	E9PFT7_HUMAN APC regulator of WNT signaling pathway (Fragment) OS=Homo sapiens OX=9606 GN=APC PE=1 SV=8
8	O95996	0.0	4564	2303	1.000	1.000	APCL_HUMAN Adenomatous polyposis coli protein 2 OS=Homo sapiens OX=9606 GN=APC2 PE=1 SV=1
9	P25054	0.0	927	2843	0.219	0.177	APC_HUMAN Adenomatous polyposis coli protein OS=Homo sapiens OX=9606 GN=APC PE=1 SV=2
10	P70039	0.0	864	2829	0.214	0.174	APC_XENLA Adenomatous polyposis coli homolog OS=Xenopus laevis OX=8355 GN=apc PE=1 SV=2
11	P70478	0.0	924	2842	0.222	0.180	APC_RAT Adenomatous polyposis coli protein OS=Rattus norvegicus OX=10116 GN=Apc PE=1 SV=1
12	Q61315	0.0	929	2845	0.221	0.179	APC_MOUSE Adenomatous polyposis coli protein OS=Mus musculus OX=10090 GN=Apc PE=1 SV=1
13	A0A126GV30	1.70e-131	457	1597	0.107	0.154	A0A126GV30_DROME APC-like, isoform C OS=Drosophila melanogaster OX=7227 GN=Apc PE=3 SV=1
14	P91667	5.99e-130	459	2416	0.107	0.102	P91667_DROME Adenomatous polyposis coli OS=Drosophila melanogaster OX=7227 GN=Apc PE=2 SV=1
15	Q9VAS9	6.84e-130	459	2417	0.107	0.102	Q9VAS9_DROME APC-like, isoform A OS=Drosophila melanogaster OX=7227 GN=Apc PE=3 SV=1
16	Q9Y1T2	1.23e-105	368	1067	0.085	0.184	Q9Y1T2_DROME Adenomatous polyposis coli 2 OS=Drosophila melanogaster OX=7227 GN=Apc2 PE=1 SV=1
17	Q961B0	7.46e-105	365	1067	0.085	0.183	Q961B0_DROME LD24920p OS=Drosophila melanogaster OX=7227 GN=Apc2 PE=2 SV=1
18	Q21227	4.39e-29	130	1188	0.043	0.083	APR1_CAEEL Adenomatous polyposis coli protein-related protein 1 OS=Caenorhabditis elegans OX=6239 GN=apr-1 PE=1 SV=2
19	Q9UQB3	5.66e-08	60.8	1225	0.027	0.051	CTND2_HUMAN Catenin delta-2 OS=Homo sapiens OX=9606 GN=CTNND2 PE=1 SV=3
20	O35927	6.62e-08	60.8	1247	0.027	0.050	CTND2_MOUSE Catenin delta-2 OS=Mus musculus OX=10090 GN=Ctnnd2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05956 APC_basic	1.8e-110	381.2	APC basic domain
2	PF16689 APC_N_CC	2.7e-27	106.0	Coiled-coil N-terminus of APC, dimerisation domain
3	PF05923 APC_r	8.6e-21	84.3	APC repeat
4	PF18797 APC_rep	1.1e-33	127.2	Adenomatous polyposis coli (APC) repeat
5	PF17675 APG6_N	2.2e+02	13.7	Apg6 coiled-coil region
6	PF00514 Arm	1.5e-18	77.4	Armadillo/beta-catenin-like repeat
7	PF16629 Arm_APC_u3	1.3e-19	82.5	Armadillo-associated region on APC
8	PF00170 bZIP_1	84	14.7	bZIP transcription factor
9	PF02183 HALZ	8.4e+02	11.6	Homeobox associated leucine zipper
10	PF05812 Herpes_BLRF2	5.9e+02	12.0	Herpesvirus BLRF2 protein
11	PF05924 SAMP	8.2e-11	52.1	SAMP Motif
12	PF11414 Suppressor_APC	1.4e-18	78.2	Adenomatous polyposis coli tumour suppressor protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000442954

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000344456	0.998	Catenin beta-1
2	9606.ENSP00000302625	0.969	Axin-2
3	9606.ENSP00000262320	0.968	Axin-1
4	9606.ENSP00000233121	0.916	Microtubule-associated protein RP/EB family member 3
5	9606.ENSP00000304669	0.912	Catenin alpha-1
6	9606.ENSP00000382004	0.912	Catenin delta-1
7	9606.ENSP00000340347	0.910	Transcription factor 7
8	9606.ENSP00000324806	0.894	Glycogen synthase kinase-3 beta
9	9606.ENSP00000316845	0.876	Rho guanine nucleotide exchange factor 4
10	9606.ENSP00000368169	0.858	Segment polarity protein dishevelled homolog DVL-1
11	9606.ENSP00000005340	0.851	Segment polarity protein dishevelled homolog DVL-2
12	9606.ENSP00000316054	0.851	Segment polarity protein dishevelled homolog DVL-3
13	9606.ENSP00000257430	0.817	Adenomatous polyposis coli protein
14	9606.ENSP00000217964	0.813	F-box-like/WD repeat-containing protein TBL1X
15	9606.ENSP00000231487	0.813	S-phase kinase-associated protein 1
16	9606.ENSP00000405574	0.813	F-box-like/WD repeat-containing protein TBL1XR1
17	9606.ENSP00000398560	0.808	Spermatogenesis-associated protein 13
18	9606.ENSP00000377508	0.799	Junction plakoglobin
19	9606.ENSP00000222330	0.749	Glycogen synthase kinase-3 alpha
20	9606.ENSP00000364721	0.731	Microtubule-associated protein RP/EB family member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008013	0.999	beta-catenin binding
GO:0008092	0.426	cytoskeletal protein binding
GO:0019900	0.332	kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0009987	0.990	cellular process
GO:0050790	0.979	regulation of catalytic activity
GO:0023051	0.965	regulation of signaling
GO:0010646	0.965	regulation of cell communication
GO:0044093	0.958	positive regulation of molecular function
GO:0090090	0.957	negative regulation of canonical Wnt signaling pathway
GO:0043087	0.924	regulation of GTPase activity
GO:0016043	0.916	cellular component organization
GO:0043085	0.885	positive regulation of catalytic activity
GO:0007017	0.875	microtubule-based process
GO:0000226	0.859	microtubule cytoskeleton organization
GO:0051345	0.841	positive regulation of hydrolase activity
GO:0043547	0.829	positive regulation of GTPase activity
GO:0090630	0.721	activation of GTPase activity
GO:0050896	0.550	response to stimulus
GO:0051716	0.531	cellular response to stimulus
GO:0019222	0.517	regulation of metabolic process
GO:0080090	0.499	regulation of primary metabolic process
GO:0051171	0.499	regulation of nitrogen compound metabolic process
GO:0060255	0.483	regulation of macromolecule metabolic process
GO:0007154	0.480	cell communication
GO:0007165	0.437	signal transduction
GO:0048518	0.431	positive regulation of biological process
GO:0048522	0.413	positive regulation of cellular process
GO:0031323	0.374	regulation of cellular metabolic process
GO:0032501	0.310	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0005829	0.985	cytosol
GO:0043232	0.977	intracellular non-membrane-bounded organelle
GO:0071944	0.969	cell periphery
GO:0005886	0.961	plasma membrane
GO:0012505	0.942	endomembrane system
GO:0032991	0.934	protein-containing complex
GO:0043227	0.929	membrane-bounded organelle
GO:0005856	0.892	cytoskeleton
GO:0043231	0.875	intracellular membrane-bounded organelle
GO:0005634	0.835	nucleus
GO:0030054	0.813	cell junction
GO:0015630	0.775	microtubule cytoskeleton
GO:0099512	0.765	supramolecular fiber
GO:0099513	0.758	polymeric cytoskeletal fiber
GO:0098590	0.748	plasma membrane region
GO:0005874	0.740	microtubule
GO:0019898	0.736	extrinsic component of membrane
GO:0019897	0.726	extrinsic component of plasma membrane
GO:0005794	0.709	Golgi apparatus
GO:0098797	0.700	plasma membrane protein complex
GO:0016342	0.683	catenin complex
GO:0031252	0.679	cell leading edge
GO:0042995	0.677	cell projection
GO:0120025	0.672	plasma membrane bounded cell projection
GO:0048471	0.637	perinuclear region of cytoplasm
GO:0015629	0.524	actin cytoskeleton
GO:0070013	0.516	intracellular organelle lumen
GO:0031253	0.516	cell projection membrane
GO:0031981	0.494	nuclear lumen
GO:0031258	0.493	lamellipodium membrane
GO:0045171	0.433	intercellular bridge
GO:0045202	0.418	synapse
GO:0005884	0.390	actin filament
GO:0030496	0.382	midbody
GO:0031941	0.377	filamentous actin
GO:0005881	0.376	cytoplasmic microtubule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]