StarFunc result for job id O95998

User Input

>input (194 residues)
MTMRHNWTPDLSPLWVLLLCAHVVTLLVRATPVSQTTTAATASVRSTKDPCPSQPPVFPA
AKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTS
RERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQ
EALPSSHSSPQQQG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95998	1.000	1.000	1.642E-35	194	1.000	1.000	O95998.pdb.gz	I18BP_HUMAN Interleukin-18-binding protein OS=Homo sapiens OX=9606 GN=IL18BP PE=1 SV=2
2	AFDB:F7F5P4	0.609	0.605	2.518E-23	195	0.629	0.626	F7F5P4.pdb.gz	F7F5P4_RAT Interleukin 18 binding protein OS=Rattus norvegicus OX=10116 GN=Il18bp PE=4 SV=2
3	AFDB:Q9JLN2	0.579	0.582	3.938E-23	193	0.619	0.622	Q9JLN2.pdb.gz	Q9JLN2_RAT Interleukin 18 binding protein OS=Rattus norvegicus OX=10116 GN=Il18bp PE=2 SV=1
4	AFDB:P27931	0.431	0.215	1.788E-7	410	0.155	0.073	P27931.pdb.gz	IL1R2_MOUSE Interleukin-1 receptor type 2 OS=Mus musculus OX=10090 GN=Il1r2 PE=1 SV=1
5	AFDB:A0A060WMR1	0.447	0.245	1.414E-6	370	0.103	0.054	A0A060WMR1.pdb.gz	A0A060WMR1_ONCMY TIR domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00035357001 PE=4 SV=1
6	AFDB:P27930	0.429	0.217	5.115E-6	398	0.129	0.063	P27930.pdb.gz	IL1R2_HUMAN Interleukin-1 receptor type 2 OS=Homo sapiens OX=9606 GN=IL1R2 PE=1 SV=1
7	AFDB:P20764	0.406	0.380	8.000E-6	209	0.175	0.163	P20764.pdb.gz	IGLL1_MOUSE Immunoglobulin lambda-like polypeptide 1 OS=Mus musculus OX=10090 GN=Igll1 PE=1 SV=3
8	AFDB:Q02955	0.407	0.147	1.183E-5	576	0.134	0.045	Q02955.pdb.gz	IL1R1_RAT Interleukin-1 receptor type 1 OS=Rattus norvegicus OX=10116 GN=Il1r1 PE=2 SV=1
9	AFDB:P15814	0.388	0.357	1.251E-5	213	0.155	0.141	P15814.pdb.gz	IGLL1_HUMAN Immunoglobulin lambda-like polypeptide 1 OS=Homo sapiens OX=9606 GN=IGLL1 PE=1 SV=1
10	AFDB:Q9NP60	0.431	0.127	1.479E-5	686	0.129	0.036	Q9NP60.pdb.gz	IRPL2_HUMAN X-linked interleukin-1 receptor accessory protein-like 2 OS=Homo sapiens OX=9606 GN=IL1RAPL2 PE=1 SV=1
11	PDB:7jg1A	0.330	0.289	6.351E-5	231	0.124	0.104	7jg1A.pdb.gz
12	PDB:3es6A	0.325	0.241	1.469E-4	277	0.093	0.065	3es6A.pdb.gz	Crystal structure of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from human seminal plasma
13	PDB:2jb5L	0.353	0.328	2.297E-4	211	0.098	0.090	2jb5L.pdb.gz	Fab Mor03268 Triggers Absorption Shift of a Diagnostic Dye Via Packaging in a Solvent-Shielded Fab Dimer Interface
14	PDB:6cplA	0.356	0.379	2.429E-4	180	0.119	0.128	6cplA.pdb.gz	CD4+T cell-mediated HLA class II cross-restriction in HIV controllers.
15	PDB:6e1iA	0.369	0.198	3.592E-4	389	0.103	0.051	6e1iA.pdb.gz
16	PDB:5j6hA	0.351	0.257	3.799E-4	275	0.103	0.073	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
17	PDB:3c2aL	0.360	0.327	5.312E-4	216	0.098	0.088	3c2aL.pdb.gz	Structure determination of an anti-HIV-1 Fab 447-52D-peptide complex from an epitaxially twinned data set
18	PDB:1a8jL	0.322	0.295	6.282E-4	216	0.098	0.088	1a8jL.pdb.gz	Treatment of osteoarthritis with aspartame.
19	PDB:3nwmA	0.348	0.191	7.025E-4	384	0.057	0.029	3nwmA.pdb.gz
20	PDB:6mp0A	0.343	0.186	8.785E-4	388	0.057	0.028	6mp0A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95998	6.46e-140	390	194	1.000	1.000	I18BP_HUMAN Interleukin-18-binding protein OS=Homo sapiens OX=9606 GN=IL18BP PE=1 SV=2
2	Q9JLN2	1.30e-71	217	193	0.624	0.627	Q9JLN2_RAT Interleukin 18 binding protein OS=Rattus norvegicus OX=10116 GN=Il18bp PE=2 SV=1
3	A0A8I6AG06	1.81e-67	206	199	0.588	0.573	A0A8I6AG06_RAT Interleukin 18 binding protein OS=Rattus norvegicus OX=10116 GN=Il18bp PE=4 SV=1
4	F7F5P4	2.68e-67	207	223	0.588	0.511	F7F5P4_RAT Interleukin 18 binding protein OS=Rattus norvegicus OX=10116 GN=Il18bp PE=4 SV=2
5	Q57W95	0.029	37.0	672	0.108	0.031	Q57W95_TRYB2 U3 small nucleolar ribonucleoprotein protein MPP10, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.28C22.1050 PE=3 SV=1
6	Q9NP60	0.061	36.2	686	0.165	0.047	IRPL2_HUMAN X-linked interleukin-1 receptor accessory protein-like 2 OS=Homo sapiens OX=9606 GN=IL1RAPL2 PE=1 SV=1
7	Q583L9	0.80	32.7	4521	0.191	0.008	Q583L9_TRYB2 Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.5F5.940 PE=4 SV=1
8	B6ZK78	3.6	30.8	681	0.160	0.046	B6ZK78_DANRE Interleukin 1-receptor accessory protein-like 2 OS=Danio rerio OX=7955 GN=si:ch211-149o12.1 PE=2 SV=1
9	Q9YHT4	5.1	30.4	583	0.098	0.033	HEM0_DANRE 5-aminolevulinate synthase, erythroid-specific, mitochondrial OS=Danio rerio OX=7955 GN=alas2 PE=2 SV=1
10	Q93YW7	5.3	30.0	341	0.175	0.100	CLS_ARATH Cardiolipin synthase (CMP-forming), mitochondrial OS=Arabidopsis thaliana OX=3702 GN=CLS PE=1 SV=1
11	F4I2T3	5.7	30.0	367	0.149	0.079	F4I2T3_ARATH Tubby like protein 8 OS=Arabidopsis thaliana OX=3702 GN=TLP8 PE=3 SV=2
12	Q57Y62	9.8	29.6	3030	0.129	0.008	Q57Y62_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.15M23.350 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05566 Pox_vIL-18BP	5.7	18.6	Orthopoxvirus interleukin 18 binding protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384212

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000280357	0.998	Interleukin-18
2	9606.ENSP00000263326	0.995	Interleukin-37
3	9606.ENSP00000264260	0.985	Interleukin-18 receptor accessory protein
4	9606.ENSP00000387211	0.957	Interleukin-18 receptor 1
5	9606.ENSP00000263341	0.649	Interleukin-1 beta
6	9606.ENSP00000433138	0.632	Caspase-1
7	9606.ENSP00000354394	0.522	Signal transducer and activator of transcription 1-alpha/beta
8	9606.ENSP00000314807	0.519	Interleukin 1 receptor accessory protein
9	9606.ENSP00000403104	0.519	Single Ig IL-1-related receptor
10	9606.ENSP00000386380	0.518	Interleukin-1 receptor type 1
11	9606.ENSP00000376896	0.514	Interleukin-36 receptor antagonist protein
12	9606.ENSP00000330959	0.510	Interleukin-1 receptor type 2
13	9606.ENSP00000376893	0.510	Interleukin-1 family member 10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0098772	0.916	molecular function regulator activity
GO:0005102	0.751	signaling receptor binding
GO:0019955	0.679	cytokine binding
GO:0042007	0.629	interleukin-18 binding
GO:0030547	0.625	signaling receptor inhibitor activity
GO:0048019	0.622	receptor antagonist activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0006955	0.988	immune response
GO:0009987	0.939	cellular process
GO:0051716	0.919	cellular response to stimulus
GO:0006950	0.869	response to stress
GO:0042221	0.849	response to chemical
GO:0002250	0.849	adaptive immune response
GO:0010033	0.841	response to organic substance
GO:0071310	0.745	cellular response to organic substance
GO:0071345	0.737	cellular response to cytokine stimulus
GO:0002460	0.714	adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0009607	0.683	response to biotic stimulus
GO:0044419	0.677	biological process involved in interspecies interaction between organisms
GO:0051707	0.671	response to other organism
GO:0009617	0.551	response to bacterium
GO:1901701	0.534	cellular response to oxygen-containing compound
GO:0033993	0.500	response to lipid
GO:0002237	0.473	response to molecule of bacterial origin
GO:0032496	0.457	response to lipopolysaccharide
GO:0034612	0.317	response to tumor necrosis factor
GO:0071356	0.308	cellular response to tumor necrosis factor

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	1.000	extracellular space
GO:0043227	0.986	membrane-bounded organelle
GO:0031982	0.937	vesicle
GO:1903561	0.722	extracellular vesicle
GO:0005622	0.718	intracellular anatomical structure
GO:0070062	0.714	extracellular exosome
GO:0005737	0.581	cytoplasm
GO:0043229	0.306	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]