StarFunc result for job id O95999

User Input

>input (233 residues)
MEPTAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRTS
SRKRAGKLLDYLQENPKGLDTLVESIRREKTQNFLIQKITDEVLKLRNIKLEHLKGLKCS
SCEPFPDGATNNLSRSNSDESNFSEKLRASTVMYHPEGESSTTPFFSTNSSLNLPVLEVG
RTENTIFSSTTLPRPGDPGAPPLPPDLQLEEEGTCANSSEMFLPLRSRTVSRQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95999	1.000	1.000	1.167E-29	233	1.000	1.000	O95999.pdb.gz	BCL10_HUMAN B-cell lymphoma/leukemia 10 OS=Homo sapiens OX=9606 GN=BCL10 PE=1 SV=1
2	AFDB:E7EC82	0.535	0.512	9.455E-20	244	0.635	0.607	E7EC82.pdb.gz	E7EC82_CHICK B-cell lymophoma 10 protein OS=Gallus gallus OX=9031 PE=2 SV=1
3	AFDB:E7F8A6	0.528	0.512	1.405E-15	241	0.489	0.473	E7F8A6.pdb.gz	E7F8A6_DANRE B-cell lymphoma/leukemia 10 isoform X1 OS=Danio rerio OX=7955 GN=bcl10 PE=4 SV=1
4	AFDB:A0A0C5AQN2	0.466	0.524	1.617E-12	207	0.343	0.386	A0A0C5AQN2.pdb.gz	A0A0C5AQN2_ONCMY BCL10 protein OS=Oncorhynchus mykiss OX=8022 GN=BCL10 PE=2 SV=1
5	AFDB:A0A0G2K3V0	0.388	0.394	1.015E-3	229	0.146	0.148	A0A0G2K3V0.pdb.gz	A0A0G2K3V0_RAT Caspase 9 OS=Rattus norvegicus OX=10116 GN=Casp9 PE=1 SV=2
6	PDB:5juyB	0.353	0.069	1.914E-3	1234	0.060	0.011	5juyB.pdb.gz	A near atomic structure of the active human apoptosome.
7	AFDB:B8A4W7	0.346	0.230	6.308E-3	364	0.167	0.107	B8A4W7.pdb.gz	B8A4W7_DANRE Mitochondrial antiviral-signaling protein OS=Danio rerio OX=7955 GN=wu:fj20d04 PE=4 SV=1
8	AFDB:C7C1L8	0.353	0.149	7.002E-3	585	0.172	0.068	C7C1L8.pdb.gz
9	AFDB:A0A1D5NS76	0.369	0.048	8.628E-3	2005	0.124	0.014	A0A1D5NS76.pdb.gz
10	AFDB:Q8BVK9	0.359	0.210	1.701E-2	445	0.163	0.085	Q8BVK9.pdb.gz	SP110_MOUSE Sp110 nuclear body protein OS=Mus musculus OX=10090 GN=Sp110 PE=1 SV=1
11	AFDB:C7C1L6	0.346	0.144	2.208E-2	606	0.189	0.073	C7C1L6.pdb.gz	C7C1L6_SALSA Mitochondrial antiviral signaling OS=Salmo salar OX=8030 GN=mavs PE=2 SV=1
12	PDB:6mksA	0.300	0.714	7.020E-2	90	0.052	0.133	6mksA.pdb.gz
13	PDB:4irlB	0.321	0.171	2.333E-1	463	0.047	0.024	4irlB.pdb.gz	Structure of the caspase-recruitment domain from a zebrafish guanylate-binding protein.
14	PDB:6ki0A	0.312	0.166	2.874E-1	459	0.073	0.037	6ki0A.pdb.gz	Homotypic CARD-CARD interaction is critical for the activation of NLRP1 inflammasome.
15	PDB:1dgnA	0.309	0.741	3.542E-1	89	0.069	0.180	1dgnA.pdb.gz
16	PDB:2kn6A	0.253	0.298	4.599E-1	195	0.060	0.072	2kn6A.pdb.gz
17	PDB:6p6cA	0.237	0.487	6.627E-1	90	0.069	0.178	6p6cA.pdb.gz
18	PDB:6tnnI	0.144	0.219	9.065E-1	134	0.069	0.119	6tnnI.pdb.gz	Structures of B. subtilis Maturation RNases Captured on 50S Ribosome with Pre-rRNAs.
19	PDB:6ybwz	0.162	0.212	9.065E-1	160	0.094	0.138	6ybwz.pdb.gz	Structure of a human 48Stranslational initiation complex.
20	PDB:2vgqA	0.318	0.169	1.006	461	0.064	0.033	2vgqA.pdb.gz	Crystal Structure of Human Ips-1 Caspase Activation Recruitment Domain

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95999	6.37e-171	471	233	1.000	1.000	BCL10_HUMAN B-cell lymphoma/leukemia 10 OS=Homo sapiens OX=9606 GN=BCL10 PE=1 SV=1
2	Q9QYN5	1.37e-154	430	233	0.914	0.914	BCL10_RAT B-cell lymphoma/leukemia 10 OS=Rattus norvegicus OX=10116 GN=Bcl10 PE=2 SV=1
3	Q9Z0H7	5.10e-154	429	233	0.910	0.910	BCL10_MOUSE B-cell lymphoma/leukemia 10 OS=Mus musculus OX=10090 GN=Bcl10 PE=1 SV=1
4	E7EC82	6.82e-89	264	244	0.635	0.607	E7EC82_CHICK B-cell lymophoma 10 protein OS=Gallus gallus OX=9031 PE=2 SV=1
5	R4GI14	5.12e-78	236	244	0.657	0.627	R4GI14_CHICK B-cell CLL/lymphoma 10 OS=Gallus gallus OX=9031 GN=BCL10 PE=4 SV=1
6	E7F8A6	2.42e-62	196	241	0.481	0.465	E7F8A6_DANRE B-cell lymphoma/leukemia 10 isoform X1 OS=Danio rerio OX=7955 GN=bcl10 PE=4 SV=1
7	A0A0C5AQN2	3.85e-42	144	207	0.361	0.406	A0A0C5AQN2_ONCMY BCL10 protein OS=Oncorhynchus mykiss OX=8022 GN=BCL10 PE=2 SV=1
8	Q2HQX3	1.83e-39	137	203	0.356	0.409	Q2HQX3_ONCMY Putative BCL-10 protein OS=Oncorhynchus mykiss OX=8022 GN=bcl10 PE=4 SV=1
9	A0A060YD78	2.54e-36	129	199	0.356	0.417	A0A060YD78_ONCMY CARD domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00034438001 PE=4 SV=1
10	Q66677	7.55e-22	93.6	311	0.197	0.148	VCLAP_EHV2 CARD domain-containing protein E10 OS=Equine herpesvirus 2 (strain 86/87) OX=82831 GN=E10 PE=1 SV=2
11	Q9YJN5	7.55e-22	93.6	311	0.197	0.148	Q9YJN5_9GAMA CARD-like apoptotic protein OS=Equid gammaherpesvirus 2 OX=12657 GN=E10 PE=2 SV=1
12	Q75HC2	0.13	35.8	1048	0.107	0.024	AGO7_ORYSJ Protein argonaute 7 OS=Oryza sativa subsp. japonica OX=39947 GN=AGO7 PE=2 SV=2
13	P19835	0.15	35.4	753	0.082	0.025	CEL_HUMAN Bile salt-activated lipase OS=Homo sapiens OX=9606 GN=CEL PE=1 SV=3
14	P78560	0.26	33.9	199	0.112	0.131	CRADD_HUMAN Death domain-containing protein CRADD OS=Homo sapiens OX=9606 GN=CRADD PE=1 SV=1
15	Q6PGZ3	0.55	33.9	629	0.077	0.029	MIPT3_DANRE TRAF3-interacting protein 1 OS=Danio rerio OX=7955 GN=traf3ip1 PE=2 SV=1
16	Q9IB67	1.2	32.3	423	0.103	0.057	Q9IB67_XENLA Caspase 2 L homeolog OS=Xenopus laevis OX=8355 GN=casp2.L PE=1 SV=1
17	O75612	4.5	30.8	612	0.082	0.031	O75612_HUMAN Carboxylic ester hydrolase (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
18	P03502	6.4	30.0	281	0.064	0.053	NS1_INBLE Non-structural protein 1 OS=Influenza B virus (strain B/Lee/1940) OX=518987 GN=NS PE=1 SV=1
19	Q9BXL6	7.1	30.4	1004	0.133	0.031	CAR14_HUMAN Caspase recruitment domain-containing protein 14 OS=Homo sapiens OX=9606 GN=CARD14 PE=1 SV=2
20	A0A494C1N2	7.3	30.4	1013	0.133	0.031	A0A494C1N2_HUMAN Caspase recruitment domain family member 14 OS=Homo sapiens OX=9606 GN=CARD14 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00619 CARD	1.7e-14	64.9	Caspase recruitment domain
2	PF02942 Flu_B_NS1	2.2e+02	12.3	Influenza B non-structural protein (NS1)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359612

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000319279	0.999	Mucosa-associated lymphoid tissue lymphoma translocation protein 1
2	9606.ENSP00000360797	0.999	Caspase recruitment domain-containing protein 9
3	9606.ENSP00000380150	0.999	Caspase recruitment domain-containing protein 11
4	9606.ENSP00000384570	0.999	Caspase recruitment domain-containing protein 10
5	9606.ENSP00000483825	0.999	NF-kappa-B essential modulator
6	9606.ENSP00000351273	0.998	Caspase-8
7	9606.ENSP00000433623	0.998	TNF receptor-associated factor 6
8	9606.ENSP00000430684	0.995	Inhibitor of nuclear factor kappa-B kinase subunit beta
9	9606.ENSP00000359424	0.986	Inhibitor of nuclear factor kappa-B kinase subunit alpha
10	9606.ENSP00000458715	0.986	Caspase recruitment domain-containing protein 14
11	9606.ENSP00000358335	0.978	Mitogen-activated protein kinase kinase kinase 7
12	9606.ENSP00000394560	0.967	Mitogen-activated protein kinase 9
13	9606.ENSP00000263464	0.960	Baculoviral IAP repeat-containing protein 3
14	9606.ENSP00000220751	0.956	Receptor-interacting serine/threonine-protein kinase 2
15	9606.ENSP00000263125	0.954	Protein kinase C theta type
16	9606.ENSP00000340305	0.936	Ubiquitin-conjugating enzyme E2 variant 1
17	9606.ENSP00000426103	0.932	E3 ubiquitin-protein ligase MIB2
18	9606.ENSP00000384273	0.920	Transcription factor p65
19	9606.ENSP00000344220	0.910	3-phosphoinositide-dependent protein kinase 1
20	9606.ENSP00000306906	0.904	E3 ubiquitin-protein ligase RNF181

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0019904	1.000	protein domain specific binding
GO:0019899	0.990	enzyme binding
GO:0002020	0.887	protease binding
GO:0019900	0.841	kinase binding
GO:0098772	0.791	molecular function regulator activity
GO:0030234	0.775	enzyme regulator activity
GO:0019901	0.760	protein kinase binding
GO:0140677	0.724	molecular function activator activity
GO:0008134	0.719	transcription factor binding
GO:0140297	0.700	DNA-binding transcription factor binding
GO:0140110	0.658	transcription regulator activity
GO:0061629	0.640	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0031625	0.639	ubiquitin protein ligase binding
GO:0008047	0.632	enzyme activator activity
GO:0003712	0.595	transcription coregulator activity
GO:0050700	0.587	CARD domain binding
GO:0043621	0.574	protein self-association
GO:0043422	0.574	protein kinase B binding
GO:0003713	0.555	transcription coactivator activity
GO:0051059	0.554	NF-kappaB binding
GO:0019209	0.545	kinase activator activity
GO:0140296	0.543	general transcription initiation factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048522	0.996	positive regulation of cellular process
GO:0065009	0.992	regulation of molecular function
GO:0010604	0.992	positive regulation of macromolecule metabolic process
GO:0048584	0.990	positive regulation of response to stimulus
GO:0009966	0.988	regulation of signal transduction
GO:0043068	0.988	positive regulation of programmed cell death
GO:0051173	0.987	positive regulation of nitrogen compound metabolic process
GO:0007165	0.987	signal transduction
GO:0006355	0.987	regulation of DNA-templated transcription
GO:0002376	0.985	immune system process
GO:0042981	0.979	regulation of apoptotic process
GO:0051246	0.979	regulation of protein metabolic process
GO:0009605	0.978	response to external stimulus
GO:0050776	0.978	regulation of immune response
GO:0009967	0.976	positive regulation of signal transduction
GO:0051091	0.976	positive regulation of DNA-binding transcription factor activity
GO:0002684	0.974	positive regulation of immune system process
GO:0051092	0.971	positive regulation of NF-kappaB transcription factor activity
GO:0043065	0.969	positive regulation of apoptotic process
GO:0051247	0.968	positive regulation of protein metabolic process
GO:0001817	0.964	regulation of cytokine production
GO:0043085	0.960	positive regulation of catalytic activity
GO:0009607	0.959	response to biotic stimulus
GO:0044419	0.957	biological process involved in interspecies interaction between organisms
GO:0010628	0.954	positive regulation of gene expression
GO:0051240	0.943	positive regulation of multicellular organismal process
GO:0006950	0.934	response to stress
GO:0043207	0.927	response to external biotic stimulus
GO:0001819	0.926	positive regulation of cytokine production
GO:0051336	0.923	regulation of hydrolase activity
GO:0030162	0.923	regulation of proteolysis
GO:0050778	0.916	positive regulation of immune response
GO:0002764	0.913	immune response-regulating signaling pathway
GO:2000116	0.905	regulation of cysteine-type endopeptidase activity
GO:0051345	0.899	positive regulation of hydrolase activity
GO:0045862	0.898	positive regulation of proteolysis
GO:0006955	0.880	immune response
GO:0002253	0.859	activation of immune response
GO:0051707	0.854	response to other organism
GO:0002757	0.852	immune response-activating signaling pathway
GO:2001056	0.851	positive regulation of cysteine-type endopeptidase activity
GO:0006952	0.838	defense response
GO:1902531	0.809	regulation of intracellular signal transduction
GO:0008219	0.771	cell death
GO:0048519	0.766	negative regulation of biological process
GO:0043281	0.761	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:2001233	0.756	regulation of apoptotic signaling pathway
GO:0042221	0.749	response to chemical
GO:0031349	0.743	positive regulation of defense response
GO:1902533	0.730	positive regulation of intracellular signal transduction
GO:0050854	0.718	regulation of antigen receptor-mediated signaling pathway
GO:0007166	0.711	cell surface receptor signaling pathway
GO:0043280	0.707	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0048523	0.690	negative regulation of cellular process
GO:0043122	0.690	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0070887	0.688	cellular response to chemical stimulus
GO:2001236	0.686	regulation of extrinsic apoptotic signaling pathway
GO:0010033	0.684	response to organic substance
GO:0032101	0.683	regulation of response to external stimulus
GO:0031325	0.682	positive regulation of cellular metabolic process
GO:0071310	0.666	cellular response to organic substance
GO:0032103	0.644	positive regulation of response to external stimulus
GO:0043123	0.630	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0002831	0.627	regulation of response to biotic stimulus
GO:2001235	0.559	positive regulation of apoptotic signaling pathway
GO:0071704	0.558	organic substance metabolic process
GO:0045088	0.558	regulation of innate immune response
GO:0031399	0.551	regulation of protein modification process
GO:0098542	0.550	defense response to other organism
GO:2001238	0.531	positive regulation of extrinsic apoptotic signaling pathway
GO:0002250	0.516	adaptive immune response
GO:1901700	0.512	response to oxygen-containing compound
GO:0045089	0.504	positive regulation of innate immune response
GO:0044238	0.476	primary metabolic process
GO:0002218	0.473	activation of innate immune response
GO:0031401	0.472	positive regulation of protein modification process
GO:0006807	0.469	nitrogen compound metabolic process
GO:0042325	0.468	regulation of phosphorylation
GO:0035556	0.459	intracellular signal transduction
GO:0009617	0.408	response to bacterium
GO:0043170	0.402	macromolecule metabolic process
GO:0071840	0.386	cellular component organization or biogenesis
GO:0031328	0.374	positive regulation of cellular biosynthetic process
GO:0045935	0.374	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.365	positive regulation of macromolecule biosynthetic process
GO:0016043	0.343	cellular component organization
GO:0032501	0.341	multicellular organismal process
GO:0002237	0.335	response to molecule of bacterial origin
GO:1901564	0.331	organonitrogen compound metabolic process
GO:0033993	0.314	response to lipid
GO:0019538	0.302	protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005829	0.998	cytosol
GO:0043229	0.875	intracellular organelle
GO:0043227	0.840	membrane-bounded organelle
GO:0043231	0.793	intracellular membrane-bounded organelle
GO:0005886	0.710	plasma membrane
GO:0043232	0.539	intracellular non-membrane-bounded organelle
GO:0140535	0.499	intracellular protein-containing complex
GO:0005634	0.445	nucleus
GO:0032449	0.396	CBM complex
GO:0099513	0.367	polymeric cytoskeletal fiber
GO:0005764	0.365	lysosome
GO:0048471	0.363	perinuclear region of cytoplasm
GO:0005881	0.355	cytoplasmic microtubule
GO:0012505	0.333	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]