StarFunc result for job id O96001

User Input

>input (155 residues)
MMSTEQMQPLELSEDRLDKLDPRCSHLDDLSDQFIKDCDLKKKPRKGKNVQATLNVESDQ
KKPRRKDTPALHIPPFIPGVFSEHLIKRYDVQERHPKGKMIPVLHNTDLEQKKPRRKDTP
ALHMSPFAAGVTLLRDERPKAIVEDDEKDGDKIAI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8CJC8	0.335	0.328	7.205E-16	159	0.813	0.792	Q8CJC8.pdb.gz
2	AFDB:Q9Z2E4	0.334	0.329	8.917E-16	159	0.800	0.780	Q9Z2E4.pdb.gz	PPR17_MOUSE Protein phosphatase 1 regulatory subunit 17 OS=Mus musculus OX=10090 GN=Ppp1r17 PE=1 SV=1
3	AFDB:Q6X855	0.270	0.271	3.592E-14	154	0.839	0.844	Q6X855.pdb.gz	Q6X855_RABIT G-substrate OS=Oryctolagus cuniculus OX=9986 GN=PPP1R17 PE=2 SV=1
4	AFDB:Q5AFI4	0.118	0.065	6.732E-1	337	0.110	0.050	Q5AFI4.pdb.gz	DFI1_CANAL Cell-surface associated glycoprotein DFI1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DFI1 PE=1 SV=1
5	AFDB:Q61817	0.157	0.078	6.732E-1	404	0.168	0.064	Q61817.pdb.gz	CREB3_MOUSE Cyclic AMP-responsive element-binding protein 3 OS=Mus musculus OX=10090 GN=Creb3 PE=2 SV=2
6	AFDB:G3C9P1	0.116	0.147	1.107	114	0.142	0.193	G3C9P1.pdb.gz	G3C9P1_HYAAE RxLR effector candidate (Fragment) OS=Hyaloperonospora arabidopsidis (strain Emoy2) OX=559515 GN=RxL44 PE=1 SV=1
7	AFDB:M0R9F7	0.127	0.053	1.107	470	0.155	0.051	M0R9F7.pdb.gz	M0R9F7_RAT Macrophage receptor with collagenous structure OS=Rattus norvegicus OX=10116 GN=Marco PE=4 SV=3
8	AFDB:F6VRR5	0.116	0.055	1.189	438	0.206	0.073	F6VRR5.pdb.gz	F6VRR5_HUMAN DNA polymerase delta interacting protein 3 OS=Homo sapiens OX=9606 GN=POLDIP3 PE=1 SV=1
9	AFDB:Q9SN78	0.127	0.083	1.370	333	0.181	0.084	Q9SN78.pdb.gz	MYB94_ARATH Transcription factor MYB94 OS=Arabidopsis thaliana OX=3702 GN=MYB94 PE=1 SV=1
10	AFDB:Q5AH63	0.136	0.127	1.471	167	0.090	0.084	Q5AH63.pdb.gz	Q5AH63_CANAL Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C702370WA PE=4 SV=1
11	PDB:6elzm	0.148	0.051	6.466	645	0.116	0.028	6elzm.pdb.gz	Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.
12	PDB:7egmI	0.130	0.174	6.466	106	0.129	0.189	7egmI.pdb.gz
13	PDB:7qsor	0.078	0.099	6.942	96	0.071	0.115	7qsor.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
14	PDB:7edxl	0.161	0.194	8.591	107	0.110	0.159	7edxl.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
15	PDB:7wtxt	0.107	0.125	9.904	132	0.071	0.083	7wtxt.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6X855	3.59e-88	256	154	0.839	0.844	Q6X855_RABIT G-substrate OS=Oryctolagus cuniculus OX=9986 GN=PPP1R17 PE=2 SV=1
2	Q9Z2E4	4.54e-86	250	159	0.800	0.780	PPR17_MOUSE Protein phosphatase 1 regulatory subunit 17 OS=Mus musculus OX=10090 GN=Ppp1r17 PE=1 SV=1
3	Q7ZTW6	1.4	31.2	505	0.161	0.050	Q7ZTW6_DANRE Cytochrome P450, family 3, subfamily c, polypeptide 1 OS=Danio rerio OX=7955 GN=CYP3A PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000340125

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363092	0.888	cGMP-dependent protein kinase 1
2	9606.ENSP00000264399	0.853	cGMP-dependent protein kinase 2
3	9606.ENSP00000221138	0.800	Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
4	9606.ENSP00000311344	0.800	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform
5	9606.ENSP00000324804	0.800	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
6	9606.ENSP00000418447	0.800	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
7	9606.ENSP00000250699	0.631	Neuronal acetylcholine receptor subunit alpha-10
8	9606.ENSP00000258302	0.627	Regulator of G-protein signaling 8
9	9606.ENSP00000430269	0.621	Bifunctional epoxide hydrolase 2
10	9606.ENSP00000424711	0.607	Clarin-2
11	9606.ENSP00000367214	0.602	Glutaredoxin domain-containing cysteine-rich protein 2
12	9606.ENSP00000316173	0.593	Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase
13	9606.ENSP00000303208	0.580	Proprotein convertase subtilisin/kexin type 9
14	9606.ENSP00000312624	0.578	Telethonin
15	9606.ENSP00000242104	0.574	Oncomodulin-1
16	9606.ENSP00000454770	0.571	Ankyrin repeat domain-containing protein 66
17	9606.ENSP00000312663	0.562	Neuronal acetylcholine receptor subunit alpha-9
18	9606.ENSP00000257627	0.555	Putative oncomodulin-2
19	9606.ENSP00000297142	0.543	Neurogenic differentiation factor 6
20	9606.ENSP00000483403	0.539	Growth hormone receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004864	1.000	protein phosphatase inhibitor activity
GO:0004865	0.570	protein serine/threonine phosphatase inhibitor activity
GO:0005515	0.443	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0019222	0.739	regulation of metabolic process
GO:0031323	0.709	regulation of cellular metabolic process
GO:0065009	0.622	regulation of molecular function
GO:0019220	0.608	regulation of phosphate metabolic process
GO:0035303	0.597	regulation of dephosphorylation
GO:0050790	0.424	regulation of catalytic activity
GO:0048523	0.402	negative regulation of cellular process
GO:0051171	0.381	regulation of nitrogen compound metabolic process
GO:0080090	0.380	regulation of primary metabolic process
GO:0060255	0.377	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0043226	0.953	organelle
GO:0043227	0.819	membrane-bounded organelle
GO:0043229	0.804	intracellular organelle
GO:0016020	0.494	membrane
GO:0043231	0.385	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]