StarFunc result for job id O96004

User Input

>input (215 residues)
MNLVGSYAHHHHHHHPHPAHPMLHEPFLFGPASRCHQERPYFQSWLLSPADAAPDFPAGG
PPPAAAAAATAYGPDARPGQSPGRLEALGGRLGRRKGSGPKKERRRTESINSAFAELREC
IPNVPADTKLSKIKTLRLATSYIAYLMDVLAKDAQSGDPEAFKAELKKADGGRESKRKRE
LQQHEGFPPALGPVEKRIKGRTGWPQQVWALELNQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P97832	0.570	0.567	9.017E-29	216	0.940	0.935	P97832.pdb.gz	HAND1_RAT Heart- and neural crest derivatives-expressed protein 1 OS=Rattus norvegicus OX=10116 GN=Hand1 PE=2 SV=2
2	AFDB:P57102	0.515	0.529	6.234E-14	208	0.530	0.548	P57102.pdb.gz	HAND2_DANRE Heart- and neural crest derivatives-expressed protein 2 OS=Danio rerio OX=7955 GN=hand2 PE=2 SV=1
3	AFDB:Q90690	0.469	0.467	2.142E-13	216	0.516	0.514	Q90690.pdb.gz	HAND2_CHICK Heart- and neural crest derivatives-expressed protein 2 OS=Gallus gallus OX=9031 GN=HAND2 PE=2 SV=1
4	AFDB:P61295	0.513	0.509	2.964E-13	217	0.530	0.525	P61295.pdb.gz	HAND2_RAT Heart- and neural crest derivatives-expressed protein 2 OS=Rattus norvegicus OX=10116 GN=Hand2 PE=2 SV=1
5	AFDB:Q7RTS1	0.308	0.348	2.065E-5	189	0.242	0.275	Q7RTS1.pdb.gz	BHA15_HUMAN Class A basic helix-loop-helix protein 15 OS=Homo sapiens OX=9606 GN=BHLHA15 PE=1 SV=1
6	AFDB:Q9VJC1	0.272	0.255	3.705E-5	232	0.256	0.237	Q9VJC1.pdb.gz	Q9VJC1_DROME GH17679p OS=Drosophila melanogaster OX=7227 GN=Oli PE=2 SV=1
7	AFDB:Q32PV5	0.303	0.364	4.502E-5	176	0.205	0.250	Q32PV5.pdb.gz	TCF21_DANRE Transcription factor 21 OS=Danio rerio OX=7955 GN=tcf21 PE=2 SV=1
8	AFDB:P59101	0.285	0.324	1.547E-4	187	0.242	0.278	P59101.pdb.gz	SCX_CHICK Basic helix-loop-helix transcription factor scleraxis OS=Gallus gallus OX=9031 GN=SCX PE=2 SV=1
9	AFDB:Q7ZSX3	0.263	0.215	2.284E-4	265	0.219	0.177	Q7ZSX3.pdb.gz	PTF1A_DANRE Pancreas transcription factor 1 subunit alpha OS=Danio rerio OX=7955 GN=ptf1a PE=2 SV=1
10	AFDB:O93507	0.237	0.160	2.962E-4	324	0.251	0.167	O93507.pdb.gz	TAL1_DANRE T-cell acute lymphocytic leukemia protein 1 homolog OS=Danio rerio OX=7955 GN=tal1 PE=1 SV=1
11	PDB:7ajtUN	0.105	0.150	2.018	147	0.074	0.109	7ajtUN.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
12	PDB:3ojaA	0.210	0.101	2.792	482	0.060	0.027	3ojaA.pdb.gz	A heterodimeric complex of the LRR proteins LRIM1 and APL1C regulates complement-like immunity in Anopheles gambiae.
13	PDB:7edxl	0.125	0.214	4.123	107	0.088	0.178	7edxl.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
14	PDB:6k15J	0.107	0.099	4.400	235	0.098	0.089	6k15J.pdb.gz	Structure of the RSC complex bound to the nucleosome.
15	PDB:3euhC	0.151	0.157	5.010	206	0.056	0.058	3euhC.pdb.gz
16	PDB:8a4bA	0.119	0.122	6.496	208	0.037	0.038	8a4bA.pdb.gz	Rep15 interacts with several Rab GTPases and has a distinct fold for a Rab effector.
17	PDB:2fshA	0.125	0.048	6.932	691	0.047	0.014	2fshA.pdb.gz	Structure of dimeric SecA, the Escherichia coli preprotein translocase motor.
18	PDB:6lssR	0.135	0.179	6.932	150	0.079	0.113	6lssR.pdb.gz	Structural snapshots of human pre-60S ribosomal particles before and after nuclear export.
19	PDB:3rx6A	0.130	0.147	7.398	187	0.065	0.075	3rx6A.pdb.gz
20	PDB:6rrdO	0.115	0.060	7.398	504	0.056	0.024	6rrdO.pdb.gz	Molecular insight into RNA polymerase I promoter recognition and promoter melting.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O96004	2.02e-158	438	215	1.000	1.000	HAND1_HUMAN Heart- and neural crest derivatives-expressed protein 1 OS=Homo sapiens OX=9606 GN=HAND1 PE=1 SV=1
2	P97832	1.30e-128	363	216	0.940	0.935	HAND1_RAT Heart- and neural crest derivatives-expressed protein 1 OS=Rattus norvegicus OX=10116 GN=Hand1 PE=2 SV=2
3	Q64279	6.09e-126	356	216	0.926	0.921	HAND1_MOUSE Heart- and neural crest derivatives-expressed protein 1 OS=Mus musculus OX=10090 GN=Hand1 PE=1 SV=1
4	P61295	6.41e-61	191	217	0.535	0.530	HAND2_RAT Heart- and neural crest derivatives-expressed protein 2 OS=Rattus norvegicus OX=10116 GN=Hand2 PE=2 SV=1
5	P61296	6.41e-61	191	217	0.535	0.530	HAND2_HUMAN Heart- and neural crest derivatives-expressed protein 2 OS=Homo sapiens OX=9606 GN=HAND2 PE=1 SV=1
6	Q61039	6.41e-61	191	217	0.535	0.530	HAND2_MOUSE Heart- and neural crest derivatives-expressed protein 2 OS=Mus musculus OX=10090 GN=Hand2 PE=1 SV=3
7	P57102	6.82e-60	188	208	0.530	0.548	HAND2_DANRE Heart- and neural crest derivatives-expressed protein 2 OS=Danio rerio OX=7955 GN=hand2 PE=2 SV=1
8	Q90690	2.20e-52	169	216	0.395	0.394	HAND2_CHICK Heart- and neural crest derivatives-expressed protein 2 OS=Gallus gallus OX=9031 GN=HAND2 PE=2 SV=1
9	Q9VL05	1.01e-30	113	174	0.298	0.368	Q9VL05_DROME FI14601p OS=Drosophila melanogaster OX=7227 GN=Hand PE=2 SV=3
10	P59101	3.90e-14	70.1	187	0.186	0.214	SCX_CHICK Basic helix-loop-helix transcription factor scleraxis OS=Gallus gallus OX=9031 GN=SCX PE=2 SV=1
11	Q60756	4.43e-13	67.4	195	0.149	0.164	TCF15_MOUSE Transcription factor 15 OS=Mus musculus OX=10090 GN=Tcf15 PE=1 SV=2
12	B5DFF0	4.88e-13	67.8	228	0.153	0.145	B5DFF0_RAT Scx protein OS=Rattus norvegicus OX=10116 GN=Scx PE=2 SV=1
13	Q12870	5.51e-13	67.0	199	0.186	0.201	TCF15_HUMAN Transcription factor 15 OS=Homo sapiens OX=9606 GN=TCF15 PE=2 SV=3
14	Q7RTU7	5.99e-13	67.0	201	0.153	0.164	SCX_HUMAN Basic helix-loop-helix transcription factor scleraxis OS=Homo sapiens OX=9606 GN=SCX PE=1 SV=1
15	Q64124	6.87e-13	67.0	207	0.153	0.159	SCX_MOUSE Basic helix-loop-helix transcription factor scleraxis OS=Mus musculus OX=10090 GN=Scx PE=1 SV=1
16	P13903	5.70e-12	63.5	166	0.158	0.205	TWIST_XENLA Twist-related protein OS=Xenopus laevis OX=8355 GN=twist1 PE=2 SV=1
17	P97831	1.18e-11	62.8	160	0.140	0.188	TWST2_RAT Twist-related protein 2 OS=Rattus norvegicus OX=10116 GN=Twist2 PE=2 SV=2
18	Q8WVJ9	1.18e-11	62.8	160	0.140	0.188	TWST2_HUMAN Twist-related protein 2 OS=Homo sapiens OX=9606 GN=TWIST2 PE=1 SV=1
19	Q9D030	1.28e-11	62.8	160	0.140	0.188	TWST2_MOUSE Twist-related protein 2 OS=Mus musculus OX=10090 GN=Twist2 PE=1 SV=1
20	Q9PTE3	1.63e-11	62.4	171	0.140	0.175	Q9PTE3_DANRE Transcription factor twist1 OS=Danio rerio OX=7955 GN=Twist1b PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00010 HLH	7.1e-14	62.8	Helix-loop-helix DNA-binding domain
2	PF18558 HTH_51	78	14.6	Helix-turn-helix domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000231121

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000327758	0.972	Homeobox protein Nkx-2.5
2	9606.ENSP00000352565	0.950	Heart- and neural crest derivatives-expressed protein 2
3	9606.ENSP00000340874	0.939	Myocyte-specific enhancer factor 2C
4	9606.ENSP00000362151	0.922	Forkhead box protein P4
5	9606.ENSP00000389377	0.910	Nuclear factor of activated T-cells, cytoplasmic 1
6	9606.ENSP00000340660	0.900	Epididymal sperm-binding protein 1
7	9606.ENSP00000355493	0.900	Adenylosuccinate synthetase isozyme 2
8	9606.ENSP00000262965	0.820	Transcription factor E2-alpha
9	9606.ENSP00000261381	0.666	Xylosyltransferase 1
10	9606.ENSP00000334458	0.665	Transcription factor GATA-4
11	9606.ENSP00000343658	0.614	Mitogen-activated protein kinase kinase kinase kinase 4
12	9606.ENSP00000346298	0.596	Sodium- and chloride-dependent transporter XTRP3
13	9606.ENSP00000311697	0.592	Fibroblast growth factor 5
14	9606.ENSP00000309913	0.584	T-box transcription factor TBX5
15	9606.ENSP00000017003	0.560	Xylosyltransferase 2
16	9606.ENSP00000370408	0.514	Homeobox protein CDX-2
17	9606.ENSP00000290573	0.504	Hexokinase-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000981	1.000	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0140297	0.999	DNA-binding transcription factor binding
GO:0000977	0.999	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.975	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.971	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0061629	0.947	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0001216	0.733	DNA-binding transcription activator activity
GO:0001228	0.718	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0042802	0.392	identical protein binding
GO:0046983	0.331	protein dimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.989	multicellular organismal process
GO:0048856	0.989	anatomical structure development
GO:0048518	0.988	positive regulation of biological process
GO:0006355	0.987	regulation of DNA-templated transcription
GO:0007275	0.982	multicellular organism development
GO:0009987	0.975	cellular process
GO:0048522	0.971	positive regulation of cellular process
GO:0007507	0.965	heart development
GO:0009893	0.948	positive regulation of metabolic process
GO:0051173	0.939	positive regulation of nitrogen compound metabolic process
GO:0010604	0.939	positive regulation of macromolecule metabolic process
GO:0006357	0.939	regulation of transcription by RNA polymerase II
GO:0009887	0.937	animal organ morphogenesis
GO:0031325	0.937	positive regulation of cellular metabolic process
GO:0009888	0.917	tissue development
GO:0003206	0.916	cardiac chamber morphogenesis
GO:0051254	0.916	positive regulation of RNA metabolic process
GO:0010557	0.913	positive regulation of macromolecule biosynthetic process
GO:0003231	0.906	cardiac ventricle development
GO:0003208	0.903	cardiac ventricle morphogenesis
GO:0060415	0.895	muscle tissue morphogenesis
GO:0048519	0.894	negative regulation of biological process
GO:0055008	0.894	cardiac muscle tissue morphogenesis
GO:0045893	0.870	positive regulation of DNA-templated transcription
GO:0003229	0.845	ventricular cardiac muscle tissue development
GO:0048523	0.787	negative regulation of cellular process
GO:0009790	0.767	embryo development
GO:0045944	0.739	positive regulation of transcription by RNA polymerase II
GO:0048646	0.633	anatomical structure formation involved in morphogenesis
GO:0043009	0.558	chordate embryonic development
GO:0009892	0.543	negative regulation of metabolic process
GO:0031324	0.510	negative regulation of cellular metabolic process
GO:0030154	0.497	cell differentiation
GO:0055010	0.484	ventricular cardiac muscle tissue morphogenesis
GO:0010605	0.482	negative regulation of macromolecule metabolic process
GO:0051172	0.445	negative regulation of nitrogen compound metabolic process
GO:0031327	0.438	negative regulation of cellular biosynthetic process
GO:0050896	0.418	response to stimulus
GO:0010558	0.390	negative regulation of macromolecule biosynthetic process
GO:0045892	0.322	negative regulation of DNA-templated transcription
GO:0071704	0.305	organic substance metabolic process
GO:0065009	0.300	regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.909	intracellular organelle lumen
GO:0032991	0.822	protein-containing complex
GO:0005654	0.815	nucleoplasm
GO:0005737	0.779	cytoplasm
GO:0043228	0.689	non-membrane-bounded organelle
GO:0043232	0.682	intracellular non-membrane-bounded organelle
GO:0005667	0.381	transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]