StarFunc result for job id O96006

User Input

>input (694 residues)
MENKSLESSQTDLKLVAHPRAKSKVWKYFGFDTNAEGCILQWKKIYCRICMAQIAYSGNT
SNLSYHLEKNHPEEFCEFVKSNTEQMREAFATAFSKLKPESSQQPGQDALAVKAGHGYDS
KKQQELTAAVLGLICEGLYPASIVDEPTFKVLLKTADPRYELPSRKYISTKAIPEKYGAV
REVILKELAEATWCGISTDMWRSENQNRAYVTLAAHFLGLGAPNCLSMGSRCLKTFEVPE
ENTAETITRVLYEVFIEWGISAKVFGATTNYGKDIVKACSLLDVAVHMPCLGHTFNAGIQ
QAFQLPKLGALLSRCRKLVEYFQQSAVAMYMLYEKQKQQNVAHCMLVSNRVSWWGSTLAM
LQRLKEQQFVIAGVLVEDSNNHHLMLEASEWATIEGLVELLQPFKQVAEMLSASRYPTIS
MVKPLLHMLLNTTLNIKETDSKELSMAKEVIAKELSKTYQETPEIDMFLNVATFLDPRYK
RLPFLSAFERQQVENRVVEEAKGLLDKVKDGGYRPAEDKIFPVPEEPPVKKLMRTSTPPP
ASVINNMLAEIFCQTGGVEDQEEWHAQVVEELSNFKSQKVLGLNEDPLKWWSDRLALFPL
LPKVLQKYWCVTATRVAPERLFGSAANVVSAKRNRLAPAHVDEQVFLYENARSGAEAEPE
DQDEGEWGLDQEQVFSLGDGVSGGFFGIRDSSFL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RBU4	0.789	0.789	2.069E-97	694	1.000	1.000	A0A024RBU4.pdb.gz
2	AFDB:O75132	0.616	0.374	6.231E-30	1171	0.210	0.125	O75132.pdb.gz	ZBED4_HUMAN Zinc finger BED domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZBED4 PE=1 SV=2
3	AFDB:Q80WQ9	0.613	0.372	4.084E-29	1168	0.213	0.127	Q80WQ9.pdb.gz	ZBED4_MOUSE Zinc finger BED domain-containing protein 4 OS=Mus musculus OX=10090 GN=Zbed4 PE=2 SV=1
4	AFDB:P86452	0.578	0.420	2.691E-26	979	0.193	0.137	P86452.pdb.gz	ZBED6_HUMAN Zinc finger BED domain-containing protein 6 OS=Homo sapiens OX=9606 GN=ZBED6 PE=1 SV=1
5	AFDB:D2EAC2	0.593	0.431	2.413E-25	980	0.199	0.141	D2EAC2.pdb.gz	ZBED6_MOUSE Zinc finger BED domain-containing protein 6 OS=Mus musculus OX=10090 GN=Zbed6 PE=1 SV=1
6	AFDB:O96083	0.535	0.525	3.157E-25	709	0.169	0.165	O96083.pdb.gz	O96083_DROME DREF transcription factor OS=Drosophila melanogaster OX=7227 GN=Dref PE=4 SV=1
7	AFDB:B9FJG3	0.584	0.563	5.402E-25	722	0.166	0.159	B9FJG3.pdb.gz	RSLE1_ORYSJ Zinc finger BED domain-containing protein RICESLEEPER 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os05g0239150 PE=3 SV=1
8	AFDB:Q75HY5	0.596	0.554	2.588E-24	752	0.174	0.161	Q75HY5.pdb.gz	RSLE3_ORYSJ Zinc finger BED domain-containing protein RICESLEEPER 3 OS=Oryza sativa subsp. japonica OX=39947 GN=Os05g0583200 PE=2 SV=1
9	AFDB:Q9M2N5	0.550	0.549	6.058E-24	696	0.167	0.167	Q9M2N5.pdb.gz	DSLE_ARATH Zinc finger BED domain-containing protein DAYSLEEPER OS=Arabidopsis thaliana OX=3702 GN=HAT PE=1 SV=1
10	AFDB:Q0JMB2	0.581	0.588	1.356E-23	684	0.163	0.165	Q0JMB2.pdb.gz	RSLE4_ORYSJ Zinc finger BED domain-containing protein RICESLEEPER 4 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0518400 PE=2 SV=3
11	PDB:4dchA	0.126	0.183	3.267E-2	434	0.040	0.065	4dchA.pdb.gz	Insights into Mechanism of Glucokinase Activation: OBSERVATION OF MULTIPLE DISTINCT PROTEIN CONFORMATIONS.
12	PDB:5weaA	0.081	0.075	4.469E-2	764	0.014	0.013	5weaA.pdb.gz	Helix-7 in Argonaute2 shapes the microRNA seed region for rapid target recognition.
13	PDB:4krfA	0.077	0.069	9.566E-2	817	0.016	0.013	4krfA.pdb.gz	The making of a slicer: activation of human argonaute-1.
14	PDB:3ngyC	0.101	0.273	1.712E-1	182	0.026	0.099	3ngyC.pdb.gz	Structural basis for RNA trimming by RNase T in stable RNA 3'-end maturation
15	PDB:7r5jB0	0.102	0.061	1.712E-1	1748	0.097	0.038	7r5jB0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
16	PDB:5c0wK	0.066	0.077	1.790E-1	576	0.073	0.089	5c0wK.pdb.gz	RNA degradation paths in a 12-subunit nuclear exosome complex.
17	PDB:7vciR	0.088	0.068	2.449E-1	1082	0.075	0.048	7vciR.pdb.gz
18	PDB:6wvdA	0.080	0.106	3.063E-1	397	0.055	0.096	6wvdA.pdb.gz
19	PDB:6ro1A	0.066	0.054	3.203E-1	919	0.065	0.049	6ro1A.pdb.gz	The MTR4 helicase recruits nuclear adaptors of the human RNA exosome using distinct arch-interacting motifs.
20	PDB:4k7rA	0.062	0.083	3.664E-1	429	0.062	0.100	4k7rA.pdb.gz	Crystal Structures of CusC Review Conformational Changes Accompanying Folding and Transmembrane Channel Formation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O96006	0.0	1445	694	1.000	1.000	ZBED1_HUMAN E3 SUMO-protein ligase ZBED1 OS=Homo sapiens OX=9606 GN=ZBED1 PE=1 SV=1
2	Q80WQ9	1.91e-36	149	1168	0.241	0.143	ZBED4_MOUSE Zinc finger BED domain-containing protein 4 OS=Mus musculus OX=10090 GN=Zbed4 PE=2 SV=1
3	O75132	3.89e-34	142	1171	0.232	0.137	ZBED4_HUMAN Zinc finger BED domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZBED4 PE=1 SV=2
4	D2EAC2	3.83e-21	101	980	0.179	0.127	ZBED6_MOUSE Zinc finger BED domain-containing protein 6 OS=Mus musculus OX=10090 GN=Zbed6 PE=1 SV=1
5	P86452	1.29e-19	96.3	979	0.135	0.096	ZBED6_HUMAN Zinc finger BED domain-containing protein 6 OS=Homo sapiens OX=9606 GN=ZBED6 PE=1 SV=1
6	Q25442	4.73e-11	68.2	612	0.154	0.175	Q25442_MUSDO Transposase OS=Musca domestica OX=7370 PE=1 SV=1
7	Q9M2N5	1.22e-10	67.0	696	0.179	0.178	DSLE_ARATH Zinc finger BED domain-containing protein DAYSLEEPER OS=Arabidopsis thaliana OX=3702 GN=HAT PE=1 SV=1
8	B9FJG3	6.22e-08	58.5	722	0.134	0.129	RSLE1_ORYSJ Zinc finger BED domain-containing protein RICESLEEPER 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os05g0239150 PE=3 SV=1
9	Q6AVI0	1.22e-07	57.4	722	0.127	0.122	RSLE2_ORYSJ Zinc finger BED domain-containing protein RICESLEEPER 2 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0733400 PE=2 SV=1
10	O96083	2.74e-06	53.1	709	0.036	0.035	O96083_DROME DREF transcription factor OS=Drosophila melanogaster OX=7227 GN=Dref PE=4 SV=1
11	Q94883	2.96e-06	53.1	709	0.033	0.032	Q94883_DROME DNA replication-related element factor, isoform A OS=Drosophila melanogaster OX=7227 GN=Dref PE=1 SV=2
12	Q86NK7	3.01e-06	53.1	709	0.033	0.032	Q86NK7_DROME LD24482p OS=Drosophila melanogaster OX=7227 GN=Dref PE=2 SV=1
13	Q0JMB2	1.02e-05	51.2	684	0.075	0.076	RSLE4_ORYSJ Zinc finger BED domain-containing protein RICESLEEPER 4 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0518400 PE=2 SV=3
14	Q75HY5	5.16e-05	48.9	752	0.127	0.117	RSLE3_ORYSJ Zinc finger BED domain-containing protein RICESLEEPER 3 OS=Oryza sativa subsp. japonica OX=39947 GN=Os05g0583200 PE=2 SV=1
15	Q5T7W0	0.54	36.2	954	0.082	0.060	ZN618_HUMAN Zinc finger protein 618 OS=Homo sapiens OX=9606 GN=ZNF618 PE=1 SV=1
16	E1C2U2	3.2	33.5	2326	0.035	0.010	RIF1_CHICK Telomere-associated protein RIF1 OS=Gallus gallus OX=9031 GN=RIF1 PE=3 SV=3
17	O75976	3.4	33.5	1380	0.032	0.016	CBPD_HUMAN Carboxypeptidase D OS=Homo sapiens OX=9606 GN=CPD PE=1 SV=2
18	O14545	4.7	32.7	582	0.045	0.053	TRAD1_HUMAN TRAF-type zinc finger domain-containing protein 1 OS=Homo sapiens OX=9606 GN=TRAFD1 PE=1 SV=1
19	Q8MQY2	9.3	32.0	896	0.020	0.016	Q8MQY2_DROME RNA polymerase II subunit A C-terminal domain phosphatase (Fragment) OS=Drosophila melanogaster OX=7227 GN=Fcp1 PE=2 SV=1
20	P08032	9.8	32.0	2415	0.046	0.013	SPTA1_MOUSE Spectrin alpha chain, erythrocytic 1 OS=Mus musculus OX=10090 GN=Spta1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05699 Dimer_Tnp_hAT	1e-11	55.8	hAT family C-terminal dimerisation region
2	PF14372 DUF4413	0.3	22.7	Domain of unknown function (DUF4413)
3	PF02892 zf-BED	6.2e-14	63.1	BED zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370621

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369716	0.938	Chromodomain-helicase-DNA-binding protein 3
2	9606.ENSP00000348056	0.928	SUMO-conjugating enzyme UBC9
3	9606.ENSP00000376077	0.905	Small ubiquitin-related modifier 1
4	9606.ENSP00000237264	0.896	TATA box-binding protein-like protein 1
5	9606.ENSP00000334113	0.867	Dehydrogenase/reductase SDR family member on chromosome X
6	9606.ENSP00000362441	0.747	Transcriptional regulator ATRX
7	9606.ENSP00000290158	0.739	Importin subunit beta-1
8	9606.ENSP00000370299	0.716	Protein Shroom2
9	9606.ENSP00000370430	0.707	Patatin-like phospholipase domain-containing protein 4
10	9606.ENSP00000433205	0.680	BRCA2-interacting transcriptional repressor EMSY
11	9606.ENSP00000360613	0.660	Ubiquitin-conjugating enzyme E2 A
12	9606.ENSP00000307208	0.656	Nucleosome-remodeling factor subunit BPTF
13	9606.ENSP00000234396	0.653	V-type proton ATPase subunit B, kidney isoform
14	9606.ENSP00000245105	0.652	SH3 domain and tetratricopeptide repeats 1
15	9606.ENSP00000344504	0.643	Histone H1.0
16	9606.ENSP00000370555	0.627	Glycogenin-2
17	9606.ENSP00000449428	0.619	Twinfilin-1
18	9606.ENSP00000217939	0.610	Matrix-remodeling-associated protein 5
19	9606.ENSP00000386184	0.603	Protein ZBED8
20	9606.ENSP00000376568	0.573	Myeloid leukemia factor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0001216	1.000	DNA-binding transcription activator activity
GO:0000981	1.000	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	1.000	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0042802	0.999	identical protein binding
GO:0019789	0.999	SUMO transferase activity
GO:0001228	0.939	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0061665	0.917	SUMO ligase activity
GO:0003713	0.915	transcription coactivator activity
GO:0000987	0.914	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.891	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0060255	0.995	regulation of macromolecule metabolic process
GO:0031326	0.995	regulation of cellular biosynthetic process
GO:0019219	0.995	regulation of nucleobase-containing compound metabolic process
GO:0048522	0.994	positive regulation of cellular process
GO:0018205	0.989	peptidyl-lysine modification
GO:0010468	0.987	regulation of gene expression
GO:0070647	0.987	protein modification by small protein conjugation or removal
GO:1903506	0.986	regulation of nucleic acid-templated transcription
GO:0045893	0.980	positive regulation of DNA-templated transcription
GO:0006357	0.977	regulation of transcription by RNA polymerase II
GO:0032446	0.975	protein modification by small protein conjugation
GO:0051851	0.959	modulation by host of symbiont process
GO:0044788	0.950	modulation by host of viral process
GO:0016925	0.941	protein sumoylation
GO:0045944	0.856	positive regulation of transcription by RNA polymerase II
GO:0009987	0.614	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0031965	1.000	nuclear membrane
GO:0005813	0.999	centrosome
GO:0005737	0.749	cytoplasm
GO:0016604	0.531	nuclear body
GO:0016605	0.379	PML body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.999	Transferases.

[back to server]