StarFunc result for job id O96014

User Input

>input (354 residues)
MRARPQVCEALLFALALQTGVCYGIKWLALSKTPSALALNQTQHCKQLEGLVSAQVQLCR
SNLELMHTVVHAAREVMKACRRAFADMRWNCSSIELAPNYLLDLERGTRESAFVYALSAA
AISHAIARACTSGDLPGCSCGPVPGEPPGPGNRWGGCADNLSYGLLMGAKFSDAPMKVKK
TGSQANKLMRLHNSEVGRQALRASLEMKCKCHGVSGSCSIRTCWKGLQELQDVAADLKTR
YLSATKVVHRPMGTRKHLVPKDLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDRQCN
KTSNGSDSCDLMCCGRGYNPYTDRVVERCHCKYHWCCYVTCRRCERTVERYVCK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G3V819	0.992	0.992	7.684E-65	354	0.975	0.975	G3V819.pdb.gz	G3V819_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt11 PE=3 SV=1
2	AFDB:P49339	0.930	0.930	1.136E-57	354	0.836	0.836	P49339.pdb.gz	WNT11_CHICK Protein Wnt-11 OS=Gallus gallus OX=9031 GN=WNT11 PE=2 SV=1
3	AFDB:Q670P5	0.932	0.938	3.456E-54	352	0.780	0.784	Q670P5.pdb.gz	WNT11_XENLA Protein Wnt-11 OS=Xenopus laevis OX=8355 GN=wnt11 PE=2 SV=1
4	AFDB:A0A0B5JSD6	0.922	0.928	3.995E-53	352	0.763	0.767	A0A0B5JSD6.pdb.gz
5	AFDB:P49893	0.948	0.951	2.270E-49	353	0.627	0.629	P49893.pdb.gz	WN11B_XENLA Protein Wnt-11b OS=Xenopus laevis OX=8355 GN=wnt11b PE=1 SV=2
6	AFDB:O73864	0.931	0.931	2.881E-47	354	0.610	0.610	O73864.pdb.gz	WNT11_DANRE Protein Wnt-11 OS=Danio rerio OX=7955 GN=wnt11 PE=2 SV=1
7	AFDB:P49337	0.884	0.892	9.271E-35	351	0.415	0.419	P49337.pdb.gz	WNT4_CHICK Protein Wnt-4 OS=Gallus gallus OX=9031 GN=WNT4 PE=1 SV=1
8	AFDB:P47793	0.861	0.865	1.732E-34	352	0.404	0.406	P47793.pdb.gz	WNT4A_DANRE Protein Wnt-4a OS=Danio rerio OX=7955 GN=wnt4a PE=2 SV=1
9	AFDB:Q3L255	0.846	0.835	1.732E-34	359	0.398	0.393	Q3L255.pdb.gz	Q3L255_CHICK Protein Wnt OS=Gallus gallus OX=9031 GN=WNT5b PE=2 SV=1
10	AFDB:A1BPR0	0.827	0.785	1.825E-34	374	0.398	0.377	A1BPR0.pdb.gz	A1BPR0_DANRE Protein Wnt OS=Danio rerio OX=7955 GN=wnt5a PE=2 SV=1
11	PDB:6ahyB	0.766	0.859	3.244E-29	313	0.345	0.390	6ahyB.pdb.gz
12	PDB:4f0aB	0.659	0.781	2.465E-23	294	0.305	0.367	4f0aB.pdb.gz	Structural basis of Wnt recognition by Frizzled.
13	PDB:6hivDD	0.125	0.072	1.720	791	0.056	0.025	6hivDD.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
14	PDB:7uzqK	0.122	0.116	1.812	380	0.059	0.055	7uzqK.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
15	PDB:6sb3A	0.076	0.046	2.119	604	0.023	0.013	6sb3A.pdb.gz
16	PDB:7kdvB	0.130	0.108	2.610	452	0.062	0.049	7kdvB.pdb.gz
17	PDB:3m73A	0.122	0.133	2.749	313	0.051	0.058	3m73A.pdb.gz
18	PDB:3zqqC	0.099	0.187	3.051	134	0.051	0.134	3zqqC.pdb.gz
19	PDB:4cniC	0.151	0.233	3.386	171	0.048	0.099	4cniC.pdb.gz
20	PDB:4v8mBR	0.062	0.106	3.567	154	0.014	0.032	4v8mBR.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G3V819	0.0	719	354	0.975	0.975	G3V819_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt11 PE=3 SV=1
2	O96014	0.0	734	354	1.000	1.000	WNT11_HUMAN Protein Wnt-11 OS=Homo sapiens OX=9606 GN=WNT11 PE=1 SV=2
3	P48615	0.0	718	354	0.975	0.975	WNT11_MOUSE Protein Wnt-11 OS=Mus musculus OX=10090 GN=Wnt11 PE=2 SV=1
4	P49339	0.0	657	354	0.850	0.850	WNT11_CHICK Protein Wnt-11 OS=Gallus gallus OX=9031 GN=WNT11 PE=2 SV=1
5	Q670P5	0.0	608	352	0.782	0.787	WNT11_XENLA Protein Wnt-11 OS=Xenopus laevis OX=8355 GN=wnt11 PE=2 SV=1
6	Q9I9I2	0.0	559	352	0.746	0.750	Q9I9I2_DANRE Protein Wnt OS=Danio rerio OX=7955 GN=wnt11r PE=2 SV=1
7	P49893	5.80e-170	479	353	0.621	0.623	WN11B_XENLA Protein Wnt-11b OS=Xenopus laevis OX=8355 GN=wnt11b PE=1 SV=2
8	O73864	1.14e-162	460	354	0.610	0.610	WNT11_DANRE Protein Wnt-11 OS=Danio rerio OX=7955 GN=wnt11 PE=2 SV=1
9	P49338	1.02e-104	313	351	0.412	0.416	WNT4_XENLA Protein Wnt-4 OS=Xenopus laevis OX=8355 GN=wnt4 PE=2 SV=1
10	P49337	1.75e-103	310	351	0.424	0.427	WNT4_CHICK Protein Wnt-4 OS=Gallus gallus OX=9031 GN=WNT4 PE=1 SV=1
11	Q9QXQ5	3.11e-103	309	351	0.410	0.413	WNT4_RAT Protein Wnt-4 OS=Rattus norvegicus OX=10116 GN=Wnt4 PE=2 SV=1
12	P56705	4.23e-102	306	351	0.407	0.410	WNT4_HUMAN Protein Wnt-4 OS=Homo sapiens OX=9606 GN=WNT4 PE=1 SV=4
13	P22724	1.92e-101	305	351	0.404	0.407	WNT4_MOUSE Protein Wnt-4 OS=Mus musculus OX=10090 GN=Wnt4 PE=1 SV=1
14	P47793	4.99e-100	301	352	0.418	0.420	WNT4A_DANRE Protein Wnt-4a OS=Danio rerio OX=7955 GN=wnt4a PE=2 SV=1
15	Q3L255	6.98e-87	268	359	0.398	0.393	Q3L255_CHICK Protein Wnt OS=Gallus gallus OX=9031 GN=WNT5b PE=2 SV=1
16	P31286	7.22e-86	266	380	0.379	0.353	WNT5A_XENLA Protein Wnt-5a OS=Xenopus laevis OX=8355 GN=wnt5a PE=2 SV=2
17	Q9H1J7	4.76e-85	263	359	0.395	0.390	WNT5B_HUMAN Protein Wnt-5b OS=Homo sapiens OX=9606 GN=WNT5B PE=2 SV=2
18	Q9QYS1	6.80e-85	263	364	0.384	0.374	WNT16_MOUSE Protein Wnt-16 OS=Mus musculus OX=10090 GN=Wnt16 PE=2 SV=2
19	P41221	1.10e-84	263	380	0.370	0.345	WNT5A_HUMAN Protein Wnt-5a OS=Homo sapiens OX=9606 GN=WNT5A PE=1 SV=2
20	P22725	1.40e-84	263	380	0.370	0.345	WNT5A_MOUSE Protein Wnt-5a OS=Mus musculus OX=10090 GN=Wnt5a PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00110 wnt	7.5e-106	365.7	wnt family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000325526

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000286201	0.958	Frizzled-7
2	9606.ENSP00000322304	0.948	Protein-serine O-palmitoleoyltransferase porcupine
3	9606.ENSP00000222462	0.926	Protein Wnt-16
4	9606.ENSP00000005340	0.922	Segment polarity protein dishevelled homolog DVL-2
5	9606.ENSP00000368169	0.920	Segment polarity protein dishevelled homolog DVL-1
6	9606.ENSP00000233948	0.914	Protein Wnt-6
7	9606.ENSP00000272164	0.914	Protein Wnt-9a
8	9606.ENSP00000290015	0.914	Protein Wnt-9b
9	9606.ENSP00000426653	0.914	Protein Wnt-8a
10	9606.ENSP00000258411	0.912	Protein Wnt-10a
11	9606.ENSP00000301061	0.911	Protein Wnt-10b
12	9606.ENSP00000264634	0.910	Protein Wnt-5a
13	9606.ENSP00000340677	0.910	Protein Wnt-8b
14	9606.ENSP00000265441	0.909	Protein Wnt-2
15	9606.ENSP00000284523	0.909	Protein Wnt-3a
16	9606.ENSP00000351605	0.909	Frizzled-6
17	9606.ENSP00000285018	0.908	Protein Wnt-7a
18	9606.ENSP00000293549	0.908	Proto-oncogene Wnt-1
19	9606.ENSP00000341032	0.908	Protein Wnt-7b
20	9606.ENSP00000358698	0.908	Protein Wnt-2b

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0140677	0.991	molecular function activator activity
GO:0030546	0.975	signaling receptor activator activity
GO:0048018	0.970	receptor ligand activity
GO:0001664	0.716	G protein-coupled receptor binding
GO:0005109	0.484	frizzled binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048856	0.995	anatomical structure development
GO:0032501	0.991	multicellular organismal process
GO:0009987	0.991	cellular process
GO:0050896	0.989	response to stimulus
GO:0050794	0.987	regulation of cellular process
GO:0007275	0.975	multicellular organism development
GO:0007154	0.969	cell communication
GO:0019222	0.947	regulation of metabolic process
GO:0048731	0.944	system development
GO:0016055	0.937	Wnt signaling pathway
GO:0048513	0.928	animal organ development
GO:0048518	0.925	positive regulation of biological process
GO:0048522	0.903	positive regulation of cellular process
GO:0009893	0.902	positive regulation of metabolic process
GO:0009888	0.895	tissue development
GO:0009653	0.889	anatomical structure morphogenesis
GO:0030111	0.858	regulation of Wnt signaling pathway
GO:0048869	0.855	cellular developmental process
GO:0030154	0.850	cell differentiation
GO:0060255	0.836	regulation of macromolecule metabolic process
GO:0048519	0.784	negative regulation of biological process
GO:0048523	0.769	negative regulation of cellular process
GO:0010604	0.764	positive regulation of macromolecule metabolic process
GO:0051171	0.763	regulation of nitrogen compound metabolic process
GO:0080090	0.760	regulation of primary metabolic process
GO:0010468	0.750	regulation of gene expression
GO:0031323	0.746	regulation of cellular metabolic process
GO:0060429	0.735	epithelium development
GO:0050793	0.732	regulation of developmental process
GO:0009887	0.717	animal organ morphogenesis
GO:0060485	0.637	mesenchyme development
GO:0009605	0.536	response to external stimulus
GO:0060021	0.497	roof of mouth development
GO:0060828	0.487	regulation of canonical Wnt signaling pathway
GO:0051252	0.477	regulation of RNA metabolic process
GO:0010556	0.465	regulation of macromolecule biosynthetic process
GO:0051173	0.459	positive regulation of nitrogen compound metabolic process
GO:0031325	0.455	positive regulation of cellular metabolic process
GO:0006355	0.446	regulation of DNA-templated transcription
GO:0051239	0.434	regulation of multicellular organismal process
GO:0009968	0.398	negative regulation of signal transduction
GO:0045935	0.393	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.387	positive regulation of macromolecule biosynthetic process
GO:0031328	0.386	positive regulation of cellular biosynthetic process
GO:0045893	0.375	positive regulation of DNA-templated transcription
GO:0030178	0.366	negative regulation of Wnt signaling pathway
GO:0042127	0.358	regulation of cell population proliferation
GO:0060070	0.336	canonical Wnt signaling pathway
GO:0048584	0.317	positive regulation of response to stimulus
GO:0010647	0.310	positive regulation of cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0005622	0.976	intracellular anatomical structure
GO:0005886	0.915	plasma membrane
GO:0005737	0.914	cytoplasm
GO:0043226	0.847	organelle
GO:0043227	0.790	membrane-bounded organelle
GO:0043231	0.749	intracellular membrane-bounded organelle
GO:0012505	0.525	endomembrane system
GO:0005615	0.320	extracellular space
GO:0070013	0.306	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]