StarFunc result for job id O96015

User Input

>input (105 residues)
MGETEGKKDEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEKFSNNNESAAKMIKET
MDKKFGSSWHVVIGEGFGFEITHEVKNLLYLYFGGTLAVCVWKCS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O96015	1.000	1.000	2.704E-22	105	1.000	1.000	O96015.pdb.gz	DNAL4_HUMAN Dynein axonemal light chain 4 OS=Homo sapiens OX=9606 GN=DNAL4 PE=1 SV=1
2	AFDB:Q38BD2	0.847	0.795	1.406E-13	112	0.448	0.420	Q38BD2.pdb.gz	Q38BD2_TRYB2 Dynein light chain OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.2520 PE=3 SV=1
3	AFDB:Q4FKD8	0.781	0.907	2.366E-10	90	0.305	0.356	Q4FKD8.pdb.gz	Q4FKD8_TRYB2 Dynein light chain OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.0845 PE=3 SV=1
4	AFDB:O94111	0.807	0.898	2.526E-10	94	0.295	0.330	O94111.pdb.gz	DYL1_EMENI Dynein light chain, cytoplasmic OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=nudG PE=3 SV=1
5	AFDB:Q1RM30	0.807	0.680	3.071E-10	126	0.276	0.230	Q1RM30.pdb.gz
6	AFDB:Q39580	0.790	0.907	3.498E-10	91	0.267	0.308	Q39580.pdb.gz	DYL1_CHLRE Dynein 8 kDa light chain, flagellar outer arm OS=Chlamydomonas reinhardtii OX=3055 PE=1 SV=1
7	AFDB:Q02647	0.822	0.935	5.520E-10	92	0.257	0.293	Q02647.pdb.gz	DYL1_YEAST Dynein light chain 1, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DYN2 PE=1 SV=1
8	PDB:4ds1A	0.788	0.955	6.671E-10	86	0.257	0.314	4ds1A.pdb.gz	Structure of a yeast Dyn2-Nup159 complex and molecular basis for dynein light chain-nuclear pore interaction.
9	AFDB:Q84VW0	0.787	0.674	6.712E-10	123	0.267	0.228	Q84VW0.pdb.gz	Q84VW0_ARATH Dynein light chain OS=Arabidopsis thaliana OX=3702 GN=DL4005W PE=1 SV=1
10	AFDB:Q9UR05	0.779	0.955	8.161E-10	85	0.295	0.365	Q9UR05.pdb.gz	DYL1_SCHPO Dynein light chain 1, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dlc2 PE=3 SV=1
11	AFDB:A0A178WMH3	0.772	0.637	3.653E-9	129	0.238	0.194	A0A178WMH3.pdb.gz	A0A178WMH3_ARATH Dynein light chain OS=Arabidopsis thaliana OX=3702 GN=At1g23220 PE=1 SV=1
12	PDB:1re6A	0.728	0.805	1.976E-8	94	0.267	0.298	1re6A.pdb.gz
13	PDB:1xdxA	0.465	0.438	1.694E-1	114	0.057	0.053	1xdxA.pdb.gz
14	PDB:2a3zB	0.271	0.130	5.843E-1	260	0.067	0.027	2a3zB.pdb.gz	Actin-bound structures of Wiskott-Aldrich syndrome protein (WASP)-homology domain 2 and the implications for filament assembly
15	PDB:1q67B	0.150	0.103	6.236E-1	161	0.067	0.043	1q67B.pdb.gz
16	PDB:6iqjB	0.171	0.150	7.105E-1	131	0.067	0.053	6iqjB.pdb.gz	Structural and computational examination of theArabidopsisprofilin-Poly-P complex reveals mechanistic details in profilin-regulated actin assembly.
17	PDB:3h0gH	0.170	0.147	8.638E-1	124	0.076	0.065	3h0gH.pdb.gz	Schizosacharomyces pombe RNA polymerase II at 3.6-A resolution.
18	PDB:4awnA	0.255	0.124	9.841E-1	260	0.076	0.031	4awnA.pdb.gz	The Structure of Human DNase I Bound to Magnesium and Phosphate Ions Points to a Catalytic Mechanism Common to Members of the DNase I-Like Superfamily.
19	PDB:3ms6A	0.257	0.284	1.050	91	0.143	0.165	3ms6A.pdb.gz
20	PDB:6lt0C	0.152	0.054	1.050	385	0.067	0.018	6lt0C.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O96015	8.32e-76	220	105	1.000	1.000	DNAL4_HUMAN Dynein axonemal light chain 4 OS=Homo sapiens OX=9606 GN=DNAL4 PE=1 SV=1
2	Q38BD2	6.72e-28	99.8	112	0.438	0.411	Q38BD2_TRYB2 Dynein light chain OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.2520 PE=3 SV=1
3	Q4FKD8	8.17e-18	73.6	90	0.305	0.356	Q4FKD8_TRYB2 Dynein light chain OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.0845 PE=3 SV=1
4	P61285	4.69e-15	66.6	89	0.286	0.337	DYL1_BOVIN Dynein light chain 1, cytoplasmic OS=Bos taurus OX=9913 GN=DYNLL1 PE=1 SV=1
5	P63167	4.69e-15	66.6	89	0.286	0.337	DYL1_HUMAN Dynein light chain 1, cytoplasmic OS=Homo sapiens OX=9606 GN=DYNLL1 PE=1 SV=1
6	P63168	4.69e-15	66.6	89	0.286	0.337	DYL1_MOUSE Dynein light chain 1, cytoplasmic OS=Mus musculus OX=10090 GN=Dynll1 PE=1 SV=1
7	P63170	4.69e-15	66.6	89	0.286	0.337	DYL1_RAT Dynein light chain 1, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Dynll1 PE=1 SV=1
8	Q9UR05	8.32e-15	65.9	85	0.305	0.376	DYL1_SCHPO Dynein light chain 1, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dlc2 PE=3 SV=1
9	O96860	1.87e-14	65.1	89	0.267	0.315	DYL2_DROME Dynein light chain 2, cytoplasmic OS=Drosophila melanogaster OX=7227 GN=Cdlc2 PE=1 SV=1
10	Q24117	2.40e-14	64.7	89	0.267	0.315	DYL1_DROME Dynein light chain 1, cytoplasmic OS=Drosophila melanogaster OX=7227 GN=ctp PE=1 SV=1
11	Q5BL99	3.66e-14	64.3	89	0.267	0.315	Q5BL99_DANRE Dynein light chain OS=Danio rerio OX=7955 GN=dynll2b PE=1 SV=1
12	Q78P75	3.82e-14	64.3	89	0.267	0.315	DYL2_RAT Dynein light chain 2, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Dynll2 PE=1 SV=1
13	Q96FJ2	3.82e-14	64.3	89	0.267	0.315	DYL2_HUMAN Dynein light chain 2, cytoplasmic OS=Homo sapiens OX=9606 GN=DYNLL2 PE=1 SV=1
14	Q9D0M5	3.82e-14	64.3	89	0.267	0.315	DYL2_MOUSE Dynein light chain 2, cytoplasmic OS=Mus musculus OX=10090 GN=Dynll2 PE=1 SV=1
15	Q7SZP6	4.98e-14	64.7	115	0.267	0.243	Q7SZP6_DANRE Dynein light chain (Fragment) OS=Danio rerio OX=7955 GN=dnl2 PE=2 SV=2
16	O94111	5.55e-14	63.9	94	0.267	0.298	DYL1_EMENI Dynein light chain, cytoplasmic OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=nudG PE=3 SV=1
17	Q22799	5.59e-14	63.9	89	0.257	0.303	DYL1_CAEEL Dynein light chain 1, cytoplasmic OS=Caenorhabditis elegans OX=6239 GN=dlc-1 PE=1 SV=1
18	Q39580	6.69e-14	63.5	91	0.267	0.308	DYL1_CHLRE Dynein 8 kDa light chain, flagellar outer arm OS=Chlamydomonas reinhardtii OX=3055 PE=1 SV=1
19	Q84VW0	1.36e-13	63.5	123	0.276	0.236	Q84VW0_ARATH Dynein light chain OS=Arabidopsis thaliana OX=3702 GN=DL4005W PE=1 SV=1
20	Q02647	1.80e-13	62.4	92	0.257	0.293	DYL1_YEAST Dynein light chain 1, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DYN2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11307 DUF3109	45	15.3	Protein of unknown function (DUF3109)
2	PF01221 Dynein_light	1.6e-23	94.2	Dynein light chain type 1
3	PF04155 Ground-like	87	15.2	Ground-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 885580.XP_010611115.1

Rank	PPI partner	STRING score	Description
1	885580.XP_010629854.1	0.925	Dynactin subunit 1
2	885580.XP_010625492.1	0.908	Dynactin subunit 4 isoform X1
3	885580.XP_010642892.1	0.896	Dynactin subunit 2
4	885580.XP_010636493.1	0.875	Beta-centractin
5	885580.XP_010624734.1	0.873	Alpha-centractin
6	885580.XP_010639749.1	0.873	Actin-related protein 10
7	885580.XP_010617560.1	0.871	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
8	885580.XP_010601699.1	0.870	Cytoplasmic dynein 1 intermediate chain 1
9	885580.XP_010621766.1	0.870	Dynactin subunit 5
10	885580.XP_010620284.1	0.864	Dynactin subunit 6
11	885580.XP_010634527.1	0.861	Dynein light chain Tctex-type 3
12	885580.XP_010607012.1	0.843	Destroys radicals which are normally produced within the cells and which are toxic to biological systems.
13	885580.XP_010610669.1	0.843	Cytoplasmic dynein 1 light intermediate chain 2
14	885580.XP_010607769.1	0.819	Uncharacterized protein
15	885580.XP_010605283.1	0.783	Cytoplasmic dynein 1 intermediate chain 2 isoform X1
16	885580.XP_010628016.1	0.775	Cytoplasmic dynein 1 light intermediate chain 1
17	885580.XP_010603397.1	0.767	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 1 base in 1 codon
18	885580.XP_010623537.1	0.767	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 16 samples with support for all annotated introns
19	885580.XP_010627211.1	0.757	Tctex1 domain-containing protein 3
20	885580.XP_010629016.1	0.733	Probable chloride channel

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003777	1.000	microtubule motor activity
GO:0042802	0.989	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0007017	0.991	microtubule-based process
GO:0007018	0.982	microtubule-based movement
GO:0071840	0.532	cellular component organization or biogenesis
GO:0016043	0.516	cellular component organization
GO:0065007	0.488	biological regulation
GO:0050789	0.412	regulation of biological process
GO:0050794	0.364	regulation of cellular process
GO:0044085	0.301	cellular component biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0043228	0.959	non-membrane-bounded organelle
GO:0005737	0.959	cytoplasm
GO:0043227	0.954	membrane-bounded organelle
GO:0005886	0.946	plasma membrane
GO:0005856	0.945	cytoskeleton
GO:0032991	0.936	protein-containing complex
GO:0005829	0.927	cytosol
GO:0015630	0.896	microtubule cytoskeleton
GO:0043231	0.722	intracellular membrane-bounded organelle
GO:0005634	0.494	nucleus
GO:1902494	0.399	catalytic complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]