StarFunc result for job id O96017

User Input

>input (543 residues)
MSRESDVEAQQSHGSSACSQPHGSVTQSQGSSSQSQGISSSSTSTMPNSSQSSHSSSGTL
SSLETVSTQELYSIPEDQEPEDQEPEEPTPAPWARLWALQDGFANLECVNDNYWFGRDKS
CEYCFDEPLLKRTDKYRTYSKKHFRIFREVGPKNSYIAYIEDHSGNGTFVNTELVGKGKR
RPLNNNSEIALSLSRNKVFVFFDLTVDDQSVYPKALRDEYIMSKTLGSGACGEVKLAFER
KTCKKVAIKIISKRKFAIGSAREADPALNVETEIEILKKLNHPCIIKIKNFFDAEDYYIV
LELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEE
DCLIKITDFGHSKILGETSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFIC
LSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEA
LRHPWLQDEDMKRKFQDLLSEENESTALPQVLAQPSTSRKRPREGEAEGAETTKRPAVCA
AVL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O96017	1.000	1.000	8.915E-100	543	1.000	1.000	O96017.pdb.gz	CHK2_HUMAN Serine/threonine-protein kinase Chk2 OS=Homo sapiens OX=9606 GN=CHEK2 PE=1 SV=1
2	AFDB:A1EAT1	0.758	0.788	6.744E-73	522	0.674	0.701	A1EAT1.pdb.gz	A1EAT1_CHICK Checkpoint and tumor suppressor protein 2 OS=Gallus gallus OX=9031 GN=CHEK2 PE=1 SV=1
3	AFDB:B0V1J5	0.728	0.782	1.183E-60	503	0.497	0.537	B0V1J5.pdb.gz
4	AFDB:O61267	0.548	0.621	3.692E-44	476	0.315	0.359	O61267.pdb.gz	LOK_DROME Ovarian-specific serine/threonine-protein kinase Lok OS=Drosophila melanogaster OX=7227 GN=lok PE=2 SV=1
5	AFDB:B7ZBF7	0.245	0.441	1.211E-39	295	0.486	0.895	B7ZBF7.pdb.gz	B7ZBF7_HUMAN Checkpoint kinase 2 (Fragment) OS=Homo sapiens OX=9606 GN=CHEK2 PE=1 SV=1
6	AFDB:Q54BF0	0.496	0.457	2.331E-36	593	0.293	0.268	Q54BF0.pdb.gz	FHKA_DICDI Probable serine/threonine-protein kinase fhkA OS=Dictyostelium discoideum OX=44689 GN=fhkA PE=3 SV=1
7	AFDB:P22216	0.463	0.314	1.726E-35	821	0.280	0.185	P22216.pdb.gz	RAD53_YEAST Serine/threonine-protein kinase RAD53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD53 PE=1 SV=1
8	AFDB:Q09170	0.616	0.718	4.696E-35	460	0.282	0.333	Q09170.pdb.gz	CDS1_SCHPO Serine/threonine-protein kinase cds1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cds1 PE=1 SV=2
9	AFDB:P24719	0.464	0.501	6.760E-29	497	0.239	0.262	P24719.pdb.gz	MEK1_YEAST Meiosis-specific serine/threonine-protein kinase MEK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MEK1 PE=1 SV=1
10	AFDB:F1QB46	0.444	0.551	1.090E-27	433	0.234	0.293	F1QB46.pdb.gz	F1QB46_DANRE Calcium/calmodulin-dependent protein kinase IG isoform X3 OS=Danio rerio OX=7955 GN=wu:fk61c03 PE=3 SV=1
11	PDB:5u6yA	0.420	0.491	8.906E-24	459	0.188	0.222	5u6yA.pdb.gz
12	PDB:8bfsA	0.420	0.803	7.790E-23	274	0.193	0.383	8bfsA.pdb.gz	Crystal structure of human calmodulin-dependent protein kinase 1D (CAMK1D) in complex with FZ326
13	PDB:4rgjA	0.407	0.472	3.820E-21	463	0.186	0.218	4rgjA.pdb.gz
14	PDB:4cztD	0.415	0.714	1.039E-20	302	0.182	0.328	4cztD.pdb.gz
15	PDB:2yaaA	0.428	0.749	1.451E-20	300	0.180	0.327	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
16	PDB:3soaA	0.420	0.516	4.931E-20	436	0.186	0.232	3soaA.pdb.gz	A Mechanism for Tunable Autoinhibition in the Structure of a Human Ca(2+)/Calmodulin- Dependent Kinase II Holoenzyme.
17	PDB:4d28C	0.415	0.778	8.133E-20	279	0.184	0.358	4d28C.pdb.gz
18	PDB:4zhxA	0.419	0.548	1.980E-19	409	0.180	0.240	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
19	PDB:5ufuA	0.428	0.615	3.650E-19	369	0.186	0.274	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
20	PDB:3uc4A	0.417	0.726	4.313E-19	295	0.171	0.315	3uc4A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1EAT1	0.0	704	522	0.615	0.640	A1EAT1_CHICK Checkpoint and tumor suppressor protein 2 OS=Gallus gallus OX=9031 GN=CHEK2 PE=1 SV=1
2	B7ZBF7	0.0	534	295	0.486	0.895	B7ZBF7_HUMAN Checkpoint kinase 2 (Fragment) OS=Homo sapiens OX=9606 GN=CHEK2 PE=1 SV=1
3	F7F4E2	0.0	775	502	0.726	0.785	F7F4E2_RAT Checkpoint kinase 2 OS=Rattus norvegicus OX=10116 GN=Chek2 PE=4 SV=1
4	O96017	0.0	1129	543	1.000	1.000	CHK2_HUMAN Serine/threonine-protein kinase Chk2 OS=Homo sapiens OX=9606 GN=CHEK2 PE=1 SV=1
5	Q9Z265	0.0	878	546	0.799	0.795	CHK2_MOUSE Serine/threonine-protein kinase Chk2 OS=Mus musculus OX=10090 GN=Chek2 PE=1 SV=1
6	Q803E2	6.79e-170	492	503	0.457	0.493	Q803E2_DANRE CHK2 checkpoint homolog (S. pombe) OS=Danio rerio OX=7955 GN=zgc:55865 PE=1 SV=1
7	A0A3B3ITA7	2.52e-126	369	176	0.324	1.000	A0A3B3ITA7_HUMAN Checkpoint kinase 2 (Fragment) OS=Homo sapiens OX=9606 GN=CHEK2 PE=1 SV=1
8	B7ZBF8	9.38e-115	338	162	0.298	1.000	B7ZBF8_HUMAN Checkpoint kinase 2 (Fragment) OS=Homo sapiens OX=9606 GN=CHEK2 PE=1 SV=2
9	O61267	2.05e-97	305	476	0.313	0.357	LOK_DROME Ovarian-specific serine/threonine-protein kinase Lok OS=Drosophila melanogaster OX=7227 GN=lok PE=2 SV=1
10	Q9U1Y5	7.92e-80	259	476	0.284	0.324	CHK2_CAEEL Serine/threonine-protein kinase chk-2 OS=Caenorhabditis elegans OX=6239 GN=chk-2 PE=2 SV=2
11	C8V3Z7	1.63e-76	255	630	0.262	0.225	C8V3Z7_EMENI Cell-cycle checkpoint serine-threonine kinase (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_04279 PE=3 SV=1
12	Q09170	3.22e-73	242	460	0.265	0.313	CDS1_SCHPO Serine/threonine-protein kinase cds1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cds1 PE=1 SV=2
13	Q6P965	5.67e-69	230	433	0.215	0.270	Q6P965_DANRE Calcium/calmodulin-dependent protein kinase IG OS=Danio rerio OX=7955 GN=zgc:73155 PE=2 SV=1
14	F1QB46	6.37e-69	230	433	0.215	0.270	F1QB46_DANRE Calcium/calmodulin-dependent protein kinase IG isoform X3 OS=Danio rerio OX=7955 GN=wu:fk61c03 PE=3 SV=1
15	P25323	5.45e-68	223	295	0.221	0.407	MYLKA_DICDI Myosin light chain kinase A OS=Dictyostelium discoideum OX=44689 GN=mlkA PE=1 SV=2
16	E7F1H0	9.26e-68	225	382	0.215	0.306	E7F1H0_DANRE Calcium/calmodulin-dependent protein kinase Ib OS=Danio rerio OX=7955 GN=camk1b PE=1 SV=1
17	Q63450	2.42e-67	224	374	0.219	0.318	KCC1A_RAT Calcium/calmodulin-dependent protein kinase type 1 OS=Rattus norvegicus OX=10116 GN=Camk1 PE=1 SV=2
18	Q91YS8	2.42e-67	224	374	0.219	0.318	KCC1A_MOUSE Calcium/calmodulin-dependent protein kinase type 1 OS=Mus musculus OX=10090 GN=Camk1 PE=1 SV=1
19	Q14012	8.74e-67	222	370	0.219	0.322	KCC1A_HUMAN Calcium/calmodulin-dependent protein kinase type 1 OS=Homo sapiens OX=9606 GN=CAMK1 PE=1 SV=1
20	Q7TNJ7	3.45e-66	224	476	0.225	0.256	KCC1G_RAT Calcium/calmodulin-dependent protein kinase type 1G OS=Rattus norvegicus OX=10116 GN=Camk1g PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	66	14.1	ABC1 atypical kinase-like domain
2	PF01636 APH	3.6e+02	12.4	Phosphotransferase enzyme family
3	PF00498 FHA	4.3e-08	44.7	FHA domain
4	PF06293 Kdo	22	15.9	Lipopolysaccharide kinase (Kdo/WaaP) family
5	PF14531 Kinase-like	0.6	21.0	Kinase-like
6	PF00069 Pkinase	4.1e-71	251.0	Protein kinase domain
7	PF17667 Pkinase_fungal	17	15.6	Fungal protein kinase
8	PF07714 PK_Tyr_Ser-Thr	1.1e-27	108.5	Protein tyrosine and serine/threonine kinase
9	PF01163 RIO1	2.6e+02	12.6	RIO1 family
10	PF10707 YrbL-PhoP_reg	78	14.4	PhoP regulatory network protein YrbL

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000015649

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000002718	0.997	Uncharacterized protein
2	9555.ENSPANP00000011874	0.996	ATR serine/threonine kinase
3	9555.ENSPANP00000010521	0.995	Serine/threonine protein kinase which activates checkpoint signaling upon double strand breaks (DSBs), apoptosis and genotoxic stresses such as ionizing ultraviolet A light (UVA), thereby acting as a DNA damage sensor. Recognizes the substrate consensus sequence [ST]- Q. Phosphorylates 'Ser-139' of histone variant H2AX/H2AFX at double strand breaks (DSBs), thereby regulating DNA damage response mechanism. Also plays a role in pre-B cell allelic exclusion, a process leading to expression of a single immunoglobulin heavy chain allele to enforce clonality and monospecific recognition by t [...]
4	9555.ENSPANP00000014979	0.993	Cell division cycle 25C
5	9555.ENSPANP00000019643	0.992	Acts as a tumor suppressor in many tumor types
6	9555.ENSPANP00000011384	0.984	Cell division cycle 25A
7	9555.ENSPANP00000020748	0.980	E3 ubiquitin-protein ligase that specifically mediates the formation of 'Lys-6'-linked polyubiquitin chains and plays a central role in DNA repair by facilitating cellular responses to DNA damage. It is unclear whether it also mediates the formation of other types of polyubiquitin chains. The E3 ubiquitin-protein ligase activity is required for its tumor suppressor function. The BRCA1-BARD1 heterodimer coordinates a diverse range of cellular pathways such as DNA damage repair, ubiquitination and transcriptional regulation to maintain genomic stability. Regulates centrosomal microtubule [...]
8	9555.ENSPANP00000016998	0.979	Cell division cycle 25B
9	9555.ENSPANP00000008222	0.978	Tumor suppressor p53-binding protein 1
10	9555.ENSPANP00000007941	0.952	MUS81 structure-specific endonuclease subunit
11	9555.ENSPANP00000018248	0.951	MDM2 proto-oncogene, E3 ubiquitin protein ligase
12	9555.ENSPANP00000006028	0.938	Serine/threonine-protein kinase PLK
13	9555.ENSPANP00000012406	0.938	Serine/threonine-protein kinase PLK
14	9555.ENSPANP00000010964	0.934	DNA helicase
15	9555.ENSPANP00000010254	0.928	Cell division cycle 45
16	9555.ENSPANP00000004650	0.924	DNA helicase
17	9555.ENSPANP00000000630	0.914	Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides
18	9555.ENSPANP00000013959	0.908	Uncharacterized protein
19	9555.ENSPANP00000005319	0.907	BRCA1 associated RING domain 1
20	9555.ENSPANP00000018646	0.906	DBF4 zinc finger

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0019899	0.675	enzyme binding
GO:0042802	0.436	identical protein binding
GO:0019900	0.402	kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.997	response to stimulus
GO:0044238	0.997	primary metabolic process
GO:0050794	0.997	regulation of cellular process
GO:0006807	0.996	nitrogen compound metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0043170	0.996	macromolecule metabolic process
GO:0042770	0.988	signal transduction in response to DNA damage
GO:0010564	0.987	regulation of cell cycle process
GO:1901564	0.977	organonitrogen compound metabolic process
GO:0000077	0.977	DNA damage checkpoint signaling
GO:0016310	0.961	phosphorylation
GO:0036211	0.936	protein modification process
GO:0006468	0.882	protein phosphorylation
GO:0048518	0.832	positive regulation of biological process
GO:0060255	0.820	regulation of macromolecule metabolic process
GO:0031323	0.789	regulation of cellular metabolic process
GO:0080090	0.780	regulation of primary metabolic process
GO:0051171	0.778	regulation of nitrogen compound metabolic process
GO:0009893	0.777	positive regulation of metabolic process
GO:0048583	0.775	regulation of response to stimulus
GO:0048522	0.769	positive regulation of cellular process
GO:0007346	0.703	regulation of mitotic cell cycle
GO:0007049	0.700	cell cycle
GO:1903047	0.690	mitotic cell cycle process
GO:0007093	0.675	mitotic cell cycle checkpoint signaling
GO:0044774	0.625	mitotic DNA integrity checkpoint signaling
GO:0044773	0.616	mitotic DNA damage checkpoint signaling
GO:0010646	0.602	regulation of cell communication
GO:0023051	0.595	regulation of signaling
GO:0072331	0.594	signal transduction by p53 class mediator
GO:0051173	0.582	positive regulation of nitrogen compound metabolic process
GO:0009966	0.580	regulation of signal transduction
GO:0071840	0.509	cellular component organization or biogenesis
GO:0010604	0.478	positive regulation of macromolecule metabolic process
GO:0016043	0.464	cellular component organization
GO:0019219	0.451	regulation of nucleobase-containing compound metabolic process
GO:0030330	0.448	DNA damage response, signal transduction by p53 class mediator
GO:0044260	0.440	cellular macromolecule metabolic process
GO:0097193	0.418	intrinsic apoptotic signaling pathway
GO:0034641	0.393	cellular nitrogen compound metabolic process
GO:1902531	0.388	regulation of intracellular signal transduction
GO:0008630	0.363	intrinsic apoptotic signaling pathway in response to DNA damage
GO:0006725	0.356	cellular aromatic compound metabolic process
GO:0046483	0.352	heterocycle metabolic process
GO:0031325	0.350	positive regulation of cellular metabolic process
GO:1901360	0.340	organic cyclic compound metabolic process
GO:0090304	0.326	nucleic acid metabolic process
GO:0006259	0.319	DNA metabolic process
GO:0018209	0.317	peptidyl-serine modification
GO:0010556	0.300	regulation of macromolecule biosynthetic process
GO:0031326	0.300	regulation of cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.985	nuclear lumen
GO:0005654	0.979	nucleoplasm
GO:0032991	0.935	protein-containing complex
GO:0005737	0.929	cytoplasm
GO:0043232	0.851	intracellular non-membrane-bounded organelle
GO:0005694	0.633	chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]