StarFunc result for job id O96018

User Input

>input (575 residues)
MDFPTISRSPSGPPAMDLEGPRDILVPSEDLTPDSQWDPMPGGPGSLSRMELDESSLQEL
VQQFEALPGDLVGPSPGGAPCPLHIATGHGLASQEIADAHGLLSAEAGRDDLLGLLHCEE
CPPSQTGPEEPLEPAPRLLQPPEDPDEDSDSPEWVEGASAEQEGSRSSSSSPEPWLETVP
LVTPEEPPAGAQSPETLASYPAPQEVPGPCDHEDLLDGVIFGARYLGSTQLVSERNPPTS
TRMAQAREAMDRVKAPDGETQPMTEVDLFVSTKRIKVLTADSQEAMMDHALHTISYTADI
GCVLVLMARRRLARRPAPQDHGRRLYKMLCHVFYAEDAQLIAQAIGQAFAAAYSQFLRES
GIDPSQVGVHPSPGACHLHNGDLDHFSNSDNCREVHLEKRRGEGLGVALVESGWGSLLPT
AVIANLLHGGPAERSGALSIGDRLTAINGTSLVGLPLAACQAAVRETKSQTSVTLSIVHC
PPVTTAIIHRPHAREQLGFCVEDGIICSLLRGGIAERGGIRVGHRIIEINGQSVVATPHA
RIIELLTEAYGEVHIKTMPAATYRLLTGQEQPVYL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O96018	1.000	1.000	2.415E-101	575	1.000	1.000	O96018.pdb.gz	APBA3_HUMAN Amyloid-beta A4 precursor protein-binding family A member 3 OS=Homo sapiens OX=9606 GN=APBA3 PE=1 SV=1
2	AFDB:O88888	0.577	0.580	3.309E-80	571	0.762	0.767	O88888.pdb.gz	APBA3_MOUSE Amyloid-beta A4 precursor protein-binding family A member 3 OS=Mus musculus OX=10090 GN=Apba3 PE=1 SV=1
3	AFDB:B2RUJ5	0.480	0.349	1.151E-57	842	0.490	0.335	B2RUJ5.pdb.gz	APBA1_MOUSE Amyloid-beta A4 precursor protein-binding family A member 1 OS=Mus musculus OX=10090 GN=Apba1 PE=1 SV=2
4	AFDB:O35431	0.462	0.370	1.700E-57	750	0.450	0.345	O35431.pdb.gz	APBA2_RAT Amyloid-beta A4 precursor protein-binding family A member 2 OS=Rattus norvegicus OX=10116 GN=Apba2 PE=1 SV=1
5	AFDB:Q9W2S5	0.421	0.138	3.000E-51	2139	0.409	0.110	Q9W2S5.pdb.gz	Q9W2S5_DROME X11Lbeta, isoform A OS=Drosophila melanogaster OX=7227 GN=X11Lbeta PE=1 SV=5
6	AFDB:D3ZWS0	0.131	0.047	4.101E-10	1663	0.186	0.064	D3ZWS0.pdb.gz	D3ZWS0_RAT Scribble planar cell polarity protein OS=Rattus norvegicus OX=10116 GN=Scrib PE=1 SV=2
7	AFDB:E2QYC9	0.145	0.053	1.001E-9	1828	0.181	0.057	E2QYC9.pdb.gz	INADL_CANLF InaD-like protein OS=Canis lupus familiaris OX=9615 GN=PATJ PE=1 SV=3
8	PDB:2xkxA	0.136	0.110	3.361E-8	721	0.089	0.071	2xkxA.pdb.gz
9	AFDB:Q9VUE8	0.165	0.047	2.413E-5	2637	0.170	0.037	Q9VUE8.pdb.gz	Q9VUE8_DROME Big bang, isoform C OS=Drosophila melanogaster OX=7227 GN=bbg PE=2 SV=2
10	PDB:7pcbA	0.143	0.195	7.373E-5	415	0.040	0.055	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
11	PDB:6pcvA	0.137	0.108	1.089E-4	754	0.054	0.041	6pcvA.pdb.gz
12	PDB:7pc3A	0.140	0.197	1.089E-4	405	0.042	0.059	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
13	AFDB:Q13387	0.199	0.142	1.359E-4	824	0.153	0.107	Q13387.pdb.gz	JIP2_HUMAN C-Jun-amino-terminal kinase-interacting protein 2 OS=Homo sapiens OX=9606 GN=MAPK8IP2 PE=1 SV=2
14	PDB:3pv2B	0.104	0.150	1.902E-4	388	0.068	0.101	3pv2B.pdb.gz
15	PDB:7p70A	0.145	0.201	2.377E-4	407	0.037	0.052	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
16	PDB:7p73A	0.138	0.186	2.377E-4	420	0.038	0.052	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
17	AFDB:B1Q240	0.158	0.101	2.509E-4	915	0.125	0.079	B1Q240.pdb.gz	B1Q240_CAEEL DiSHevelled related OS=Caenorhabditis elegans OX=6239 GN=dsh-1 PE=1 SV=2
18	PDB:5n7dA	0.137	0.182	3.714E-4	423	0.038	0.052	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
19	PDB:7pc5A	0.141	0.197	6.857E-4	405	0.040	0.057	7pc5A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
20	PDB:6r9tA	0.124	0.035	2.472E-3	2185	0.023	0.006	6r9tA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O70248	0.0	826	569	0.743	0.750	APBA3_RAT Amyloid-beta A4 precursor protein-binding family A member 3 OS=Rattus norvegicus OX=10116 GN=Apba3 PE=1 SV=2
2	O88888	0.0	807	571	0.762	0.767	APBA3_MOUSE Amyloid-beta A4 precursor protein-binding family A member 3 OS=Mus musculus OX=10090 GN=Apba3 PE=1 SV=1
3	O96018	0.0	1159	575	1.000	1.000	APBA3_HUMAN Amyloid-beta A4 precursor protein-binding family A member 3 OS=Homo sapiens OX=9606 GN=APBA3 PE=1 SV=1
4	Q02410	2.17e-178	527	837	0.445	0.306	APBA1_HUMAN Amyloid-beta A4 precursor protein-binding family A member 1 OS=Homo sapiens OX=9606 GN=APBA1 PE=1 SV=3
5	B2RUJ5	4.55e-177	523	842	0.435	0.297	APBA1_MOUSE Amyloid-beta A4 precursor protein-binding family A member 1 OS=Mus musculus OX=10090 GN=Apba1 PE=1 SV=2
6	O35430	3.35e-176	521	839	0.433	0.297	APBA1_RAT Amyloid-beta A4 precursor protein-binding family A member 1 OS=Rattus norvegicus OX=10116 GN=Apba1 PE=1 SV=1
7	P98084	8.34e-170	502	750	0.430	0.329	APBA2_MOUSE Amyloid-beta A4 precursor protein-binding family A member 2 OS=Mus musculus OX=10090 GN=Apba2 PE=1 SV=2
8	O35431	1.27e-169	501	750	0.430	0.329	APBA2_RAT Amyloid-beta A4 precursor protein-binding family A member 2 OS=Rattus norvegicus OX=10116 GN=Apba2 PE=1 SV=1
9	Q99767	6.89e-169	499	749	0.428	0.328	APBA2_HUMAN Amyloid-beta A4 precursor protein-binding family A member 2 OS=Homo sapiens OX=9606 GN=APBA2 PE=1 SV=3
10	M9PGU7	6.74e-128	415	2066	0.357	0.099	M9PGU7_DROME X11Lbeta, isoform D OS=Drosophila melanogaster OX=7227 GN=X11Lbeta PE=4 SV=2
11	X2JB44	9.95e-128	415	2129	0.357	0.096	X2JB44_DROME X11Lbeta, isoform E OS=Drosophila melanogaster OX=7227 GN=X11Lbeta PE=4 SV=1
12	Q5BI79	2.26e-127	410	1603	0.357	0.128	Q5BI79_DROME LP19469p (Fragment) OS=Drosophila melanogaster OX=7227 GN=X11Lbeta PE=2 SV=1
13	Q9W2S5	5.51e-126	410	2139	0.357	0.096	Q9W2S5_DROME X11Lbeta, isoform A OS=Drosophila melanogaster OX=7227 GN=X11Lbeta PE=1 SV=5
14	M9PF12	6.48e-125	397	1162	0.360	0.178	M9PF12_DROME X11L, isoform E OS=Drosophila melanogaster OX=7227 GN=X11L PE=4 SV=2
15	E1JJN6	1.17e-124	396	1168	0.358	0.176	E1JJN6_DROME X11L, isoform B OS=Drosophila melanogaster OX=7227 GN=X11L PE=4 SV=1
16	Q9VX41	1.41e-124	396	1167	0.358	0.177	Q9VX41_DROME LD29081p OS=Drosophila melanogaster OX=7227 GN=X11L PE=1 SV=2
17	Q9GQQ6	1.73e-124	395	1168	0.358	0.176	Q9GQQ6_DROME DX11 OS=Drosophila melanogaster OX=7227 GN=X11L PE=1 SV=1
18	X2JE74	1.07e-122	391	1170	0.358	0.176	X2JE74_DROME X11L, isoform F OS=Drosophila melanogaster OX=7227 GN=X11L PE=4 SV=1
19	O17583	9.28e-122	384	982	0.341	0.200	LIN10_CAEEL Protein lin-10 OS=Caenorhabditis elegans OX=6239 GN=lin-10 PE=1 SV=1
20	B5X137	4.13e-12	69.7	301	0.085	0.163	B5X137_SALSA Syntenin-1 OS=Salmo salar OX=8030 GN=SDCB1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16733 NRho	44	15.7	Rhomboid N-terminal domain
2	PF00595 PDZ	1.8e-25	100.4	PDZ domain
3	PF13180 PDZ_2	0.9	21.3	PDZ domain
4	PF17820 PDZ_6	5.9e-13	59.8	PDZ domain
5	PF02163 Peptidase_M50	14	16.4	Peptidase family M50
6	PF00640 PID	1.9e-40	149.6	Phosphotyrosine interaction domain (PTB/PID)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000315136

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000299163	0.939	Hypoxia-inducible factor 1-alpha inhibitor
2	9606.ENSP00000284981	0.905	Amyloid-beta A4 protein
3	9606.ENSP00000311449	0.900	Ras-related protein Rab-6A
4	9606.ENSP00000362399	0.794	Syntaxin-binding protein 1
5	9606.ENSP00000263574	0.788	Amyloid-like protein 2
6	9606.ENSP00000246190	0.749	N-terminal EF-hand calcium-binding protein 3
7	9606.ENSP00000255784	0.731	Coiled-coil domain-containing protein 134
8	9606.ENSP00000396452	0.717	Pseudouridine-5'-phosphatase
9	9606.ENSP00000222812	0.648	Syntaxin-1A
10	9606.ENSP00000040877	0.646	Probable methyltransferase TARBP1
11	9606.ENSP00000346001	0.638	60S ribosomal protein L3
12	9606.ENSP00000385142	0.628	Neurexin-1
13	9606.ENSP00000265459	0.627	Neurexin-2
14	9606.ENSP00000477213	0.626	Amyloid-beta A4 precursor protein-binding family B member 1
15	9606.ENSP00000451648	0.624	Neurexin-3
16	9606.ENSP00000392985	0.609	Oxidoreductase HTATIP2
17	9606.ENSP00000458663	0.588	Protein capicua homolog
18	9606.ENSP00000367408	0.574	Peripheral plasma membrane protein CASK
19	9606.ENSP00000346378	0.568	Amyloid-beta A4 precursor protein-binding family B member 3
20	9606.ENSP00000430276	0.561	Proto-oncogene DBL

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.967	enzyme binding
GO:0140678	0.937	molecular function inhibitor activity
GO:0030234	0.931	enzyme regulator activity
GO:0004857	0.924	enzyme inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0009987	0.980	cellular process
GO:0050789	0.917	regulation of biological process
GO:0065009	0.752	regulation of molecular function
GO:0050794	0.747	regulation of cellular process
GO:0050790	0.689	regulation of catalytic activity
GO:0032501	0.593	multicellular organismal process
GO:0044092	0.560	negative regulation of molecular function
GO:0048856	0.523	anatomical structure development
GO:0019222	0.480	regulation of metabolic process
GO:0060255	0.461	regulation of macromolecule metabolic process
GO:0043086	0.428	negative regulation of catalytic activity
GO:0007275	0.405	multicellular organism development
GO:0010468	0.306	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0016020	0.973	membrane
GO:0043226	0.955	organelle
GO:0043229	0.953	intracellular organelle
GO:0043231	0.942	intracellular membrane-bounded organelle
GO:0071944	0.885	cell periphery
GO:0048471	0.817	perinuclear region of cytoplasm
GO:0012505	0.699	endomembrane system
GO:0005886	0.697	plasma membrane
GO:0005829	0.680	cytosol
GO:0030054	0.387	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]