StarFunc result for job id O96019

User Input

>input (429 residues)
MSGGVYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERDDGSTLMEIDGDK
GKQGGPTYYIDTNALRVPRENMEAISPLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPV
LMSEAPWNTRAKREKLTELMFEHYNIPAFFLCKTAVLTAFANGRSTGLILDSGATHTTAI
PVHDGYVLQQGIVKSPLAGDFITMQCRELFQEMNIELVPPYMIASKEAVREGSPANWKRK
EKLPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAE
RLKIPEGLFDPSNVKGLSGNTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGNTLIQSF
TDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQEYEEGG
KQCVERKCP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O96019	1.000	1.000	2.290E-88	429	1.000	1.000	O96019.pdb.gz	ACL6A_HUMAN Actin-like protein 6A OS=Homo sapiens OX=9606 GN=ACTL6A PE=1 SV=1
2	AFDB:O94805	0.969	0.976	4.445E-78	426	0.834	0.840	O94805.pdb.gz	ACL6B_HUMAN Actin-like protein 6B OS=Homo sapiens OX=9606 GN=ACTL6B PE=1 SV=1
3	AFDB:Q7K012	0.926	0.934	7.012E-60	425	0.555	0.560	Q7K012.pdb.gz	Q7K012_DROME Brahma associated protein 55kD OS=Drosophila melanogaster OX=7227 GN=Bap55 PE=1 SV=1
4	AFDB:Q84M92	0.903	0.879	3.560E-50	441	0.424	0.413	Q84M92.pdb.gz	ARP4_ARATH Actin-related protein 4 OS=Arabidopsis thaliana OX=3702 GN=ARP4 PE=1 SV=1
5	AFDB:Q9P7X7	0.881	0.873	1.242E-46	433	0.354	0.351	Q9P7X7.pdb.gz	ARP4_SCHPO Actin-related protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alp5 PE=3 SV=1
6	AFDB:Q54UQ7	0.881	0.860	2.296E-46	440	0.378	0.368	Q54UQ7.pdb.gz	Q54UQ7_DICDI Actin-like protein 6A OS=Dictyostelium discoideum OX=44689 GN=arpD PE=3 SV=1
7	PDB:6ltjJ	0.737	0.942	4.762E-46	334	0.774	0.994	6ltjJ.pdb.gz	Structure of nucleosome-bound human BAF complex.
8	AFDB:Q09849	0.898	0.909	6.935E-45	424	0.333	0.337	Q09849.pdb.gz	ARP42_SCHPO SWI/SNF and RSC complexes subunit arp42 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=arp42 PE=1 SV=2
9	AFDB:P07829	0.787	0.894	2.334E-38	376	0.333	0.380	P07829.pdb.gz	ACT3_DICDI Actin-3 OS=Dictyostelium discoideum OX=44689 GN=act3 PE=3 SV=3
10	AFDB:Q4YU79	0.780	0.886	3.263E-38	376	0.324	0.370	Q4YU79.pdb.gz	ACT2_PLABA Actin-2 OS=Plasmodium berghei (strain Anka) OX=5823 GN=ACT2 PE=1 SV=1
11	AFDB:A0A1D8PFR4	0.801	0.909	3.859E-38	376	0.326	0.372	A0A1D8PFR4.pdb.gz	A0A1D8PFR4_CANAL Actin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ACT1 PE=3 SV=1
12	PDB:1c0gA	0.787	0.913	5.911E-36	368	0.329	0.383	1c0gA.pdb.gz	Structural basis for the higher Ca(2+)-activation of the regulated actin-activated myosin ATPase observed with Dictyostelium/Tetrahymena actin chimeras.
13	PDB:6tu4A	0.766	0.876	1.528E-35	372	0.303	0.349	6tu4A.pdb.gz	High-resolution structures of malaria parasite actomyosin and actin filaments.
14	PDB:1yagA	0.798	0.916	2.260E-35	372	0.338	0.390	1yagA.pdb.gz	The structure of nonvertebrate actin: Implications for the ATP hydrolytic mechanism
15	PDB:5i9eC	0.833	0.883	9.658E-35	404	0.275	0.292	5i9eC.pdb.gz	Crystal structure of a nuclear actin ternary complex.
16	PDB:3qb0B	0.829	0.827	2.952E-34	430	0.282	0.281	3qb0B.pdb.gz	Structural biochemistry of nuclear actin-related proteins 4 and 8 reveals their interaction with actin.
17	PDB:4cbxA	0.772	0.920	1.067E-33	358	0.312	0.374	4cbxA.pdb.gz	Structural Differences Explain Diverse Functions of Plasmodium Actins.
18	PDB:4pl7A	0.759	0.849	5.267E-31	382	0.319	0.359	4pl7A.pdb.gz	Structural basis of thymosin-beta 4/profilin exchange leading to actin filament polymerization.
19	PDB:4a7fA	0.747	0.846	6.431E-29	375	0.333	0.381	4a7fA.pdb.gz	Structure of the Rigor Actin-Tropomyosin-Myosin Complex.
20	PDB:5tgcD	0.753	0.755	4.637E-25	428	0.212	0.213	5tgcD.pdb.gz	Actin-related proteins regulate the RSC chromatin remodeler by weakening intramolecular interactions of the Sth1 ATPase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AT89	0.0	880	424	0.970	0.981	A0A8I6AT89_RAT Actin-like 6A OS=Rattus norvegicus OX=10116 GN=Actl6a PE=1 SV=1
2	O94805	0.0	756	426	0.834	0.840	ACL6B_HUMAN Actin-like protein 6B OS=Homo sapiens OX=9606 GN=ACTL6B PE=1 SV=1
3	O96019	0.0	901	429	1.000	1.000	ACL6A_HUMAN Actin-like protein 6A OS=Homo sapiens OX=9606 GN=ACTL6A PE=1 SV=1
4	P86173	0.0	746	426	0.830	0.836	ACL6B_RAT Actin-like protein 6B OS=Rattus norvegicus OX=10116 GN=Actl6b PE=1 SV=2
5	Q4KM87	0.0	894	429	0.986	0.986	Q4KM87_RAT Actin-like 6A OS=Rattus norvegicus OX=10116 GN=Actl6a PE=1 SV=1
6	Q99MR0	0.0	746	426	0.830	0.836	ACL6B_MOUSE Actin-like protein 6B OS=Mus musculus OX=10090 GN=Actl6b PE=1 SV=1
7	Q9Z2N8	0.0	895	429	0.988	0.988	ACL6A_MOUSE Actin-like protein 6A OS=Mus musculus OX=10090 GN=Actl6a PE=1 SV=2
8	Q7K012	1.26e-177	504	425	0.557	0.562	Q7K012_DROME Brahma associated protein 55kD OS=Drosophila melanogaster OX=7227 GN=Bap55 PE=1 SV=1
9	Q84M92	2.10e-126	374	441	0.436	0.424	ARP4_ARATH Actin-related protein 4 OS=Arabidopsis thaliana OX=3702 GN=ARP4 PE=1 SV=1
10	Q54UQ7	3.47e-95	295	440	0.403	0.393	Q54UQ7_DICDI Actin-like protein 6A OS=Dictyostelium discoideum OX=44689 GN=arpD PE=3 SV=1
11	P07830	2.53e-84	265	376	0.357	0.407	ACT1_DICDI Major actin OS=Dictyostelium discoideum OX=44689 GN=act1 PE=1 SV=2
12	Q54GX7	2.82e-84	264	376	0.357	0.407	ACT10_DICDI Actin-10 OS=Dictyostelium discoideum OX=44689 GN=act10 PE=1 SV=1
13	Q553U6	5.80e-84	263	376	0.354	0.404	ACT22_DICDI Putative actin-22 OS=Dictyostelium discoideum OX=44689 GN=act22 PE=3 SV=1
14	A0A1D8PFR4	1.33e-82	260	376	0.350	0.399	A0A1D8PFR4_CANAL Actin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ACT1 PE=3 SV=1
15	P53492	2.64e-82	259	377	0.352	0.401	ACT7_ARATH Actin-7 OS=Arabidopsis thaliana OX=3702 GN=ACT7 PE=1 SV=1
16	Q6IQR3	4.43e-82	259	377	0.357	0.406	Q6IQR3_DANRE Actin alpha cardiac muscle 1a OS=Danio rerio OX=7955 GN=actc1l PE=2 SV=1
17	P10986	5.57e-82	258	376	0.357	0.407	ACT4_CAEEL Actin-4 OS=Caenorhabditis elegans OX=6239 GN=act-4 PE=3 SV=2
18	P0DM41	1.11e-81	258	376	0.354	0.404	ACT1_CAEEL Actin-1 OS=Caenorhabditis elegans OX=6239 GN=act-1 PE=1 SV=1
19	P0DM42	1.11e-81	258	376	0.354	0.404	ACT3_CAEEL Actin-3 OS=Caenorhabditis elegans OX=6239 GN=act-3 PE=3 SV=1
20	P10981	1.12e-81	258	376	0.352	0.402	ACT5_DROME Actin-87E OS=Drosophila melanogaster OX=7227 GN=Act87E PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00022 Actin	2.4e-138	472.6	Actin
2	PF06723 MreB_Mbl	15	15.9	MreB/Mbl protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010372176.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010372033.1	0.999	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4
2	61622.XP_010378704.1	0.999	AT-rich interaction domain 1A
3	61622.XP_010383661.1	0.999	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 isoform X1
4	61622.XP_010386815.1	0.999	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 isoform X1
5	61622.XP_010368133.1	0.997	Belongs to the SNF5 family.
6	61622.XP_010373046.1	0.997	SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily c member 1
7	61622.XP_010376163.1	0.997	SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily c member 2
8	61622.XP_010378258.1	0.997	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3
9	61622.XP_010378336.1	0.997	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2 isoform X1
10	61622.XP_010386649.1	0.995	PHD finger protein 10
11	61622.XP_010362714.1	0.994	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2
12	61622.XP_010354947.1	0.993	Proposed core component of the chromatin remodeling Ino80 complex which exhibits DNA- and nucleosome-activated ATPase activity and catalyzes ATP-dependent nucleosome sliding.
13	61622.XP_010363299.1	0.992	Protein polybromo-1 isoform X1
14	61622.XP_010379853.1	0.992	AT-rich interactive domain-containing protein 1B
15	61622.XP_010366915.1	0.991	Proposed core component of the chromatin remodeling Ino80 complex which exhibits DNA- and nucleosome-activated ATPase activity and catalyzes ATP-dependent nucleosome sliding.
16	61622.XP_010370213.1	0.989	DNA methyltransferase 1-associated protein 1 isoform X1
17	61622.XP_010364766.1	0.988	Belongs to the MYST (SAS/MOZ) family.
18	61622.XP_010367340.1	0.986	INO80 complex subunit
19	61622.XP_010355993.1	0.983	AT-rich interactive domain-containing protein 4A isoform X1
20	61622.XP_010382951.1	0.983	AT-rich interactive domain-containing protein 4B isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003682	0.998	chromatin binding
GO:1901363	0.948	heterocyclic compound binding
GO:0097159	0.948	organic cyclic compound binding
GO:0044877	0.928	protein-containing complex binding
GO:0003676	0.658	nucleic acid binding
GO:0008092	0.329	cytoskeletal protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.992	multicellular organismal process
GO:0009987	0.985	cellular process
GO:0007275	0.981	multicellular organism development
GO:0071840	0.891	cellular component organization or biogenesis
GO:0016043	0.860	cellular component organization
GO:0048731	0.859	system development
GO:0050789	0.823	regulation of biological process
GO:0050794	0.784	regulation of cellular process
GO:0019222	0.682	regulation of metabolic process
GO:0060255	0.654	regulation of macromolecule metabolic process
GO:0080090	0.632	regulation of primary metabolic process
GO:0051171	0.632	regulation of nitrogen compound metabolic process
GO:0021510	0.610	spinal cord development
GO:0048518	0.547	positive regulation of biological process
GO:0031323	0.515	regulation of cellular metabolic process
GO:0048522	0.498	positive regulation of cellular process
GO:0019219	0.434	regulation of nucleobase-containing compound metabolic process
GO:0008152	0.414	metabolic process
GO:0009893	0.385	positive regulation of metabolic process
GO:0071704	0.378	organic substance metabolic process
GO:0006325	0.369	chromatin organization
GO:0044238	0.349	primary metabolic process
GO:0006807	0.336	nitrogen compound metabolic process
GO:0006338	0.326	chromatin remodeling
GO:0010604	0.326	positive regulation of macromolecule metabolic process
GO:0043170	0.323	macromolecule metabolic process
GO:0051173	0.313	positive regulation of nitrogen compound metabolic process
GO:0031325	0.312	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1902494	0.999	catalytic complex
GO:0000785	0.999	chromatin
GO:0140513	0.999	nuclear protein-containing complex
GO:0070603	0.985	SWI/SNF superfamily-type complex
GO:0031981	0.967	nuclear lumen
GO:0005654	0.948	nucleoplasm
GO:0016514	0.867	SWI/SNF complex
GO:0005737	0.524	cytoplasm
GO:1990234	0.433	transferase complex
GO:0140535	0.419	intracellular protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]