StarFunc result for job id O96020

User Input

>input (404 residues)
MSRRSSRLQAKQQPQPSQTESPQEAQIIQAKKRKTTQDVKKRREEVTKKHQYEIRNCWPP
VLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSKEVWLNMLKK
ESRYVHDKHFEVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDI
NKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILRMELIILKALKWELCP
VTIISWLNLFLQVDALKDAPKVLLPQYSQETFIQIAQLLDLCILAIDSLEFQYRILTAAA
LCHFTSIEVVKKASGLEWDSISECVDWMVPFVNVVKSTSPVKLKTFKKIPMEDRHNIQTH
TNYLAMLEEVNYINTFRKGGQLSPVCNGGIMTPPKSTEKPPGKH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZQ41	0.800	0.798	1.120E-48	405	0.928	0.926	D3ZQ41.pdb.gz	D3ZQ41_RAT Cyclin E2 OS=Rattus norvegicus OX=10116 GN=Ccne2 PE=3 SV=1
2	AFDB:P47794	0.711	0.701	5.183E-32	410	0.460	0.454	P47794.pdb.gz	CCNE1_DANRE G1/S-specific cyclin-E1 OS=Danio rerio OX=7955 GN=ccne1 PE=2 SV=1
3	AFDB:P39949	0.710	0.699	6.445E-31	411	0.460	0.453	P39949.pdb.gz	CCNE1_RAT G1/S-specific cyclin-E1 OS=Rattus norvegicus OX=10116 GN=Ccne1 PE=1 SV=2
4	AFDB:P24864	0.722	0.712	1.292E-30	410	0.478	0.471	P24864.pdb.gz	CCNE1_HUMAN G1/S-specific cyclin-E1 OS=Homo sapiens OX=9606 GN=CCNE1 PE=1 SV=2
5	AFDB:C9J2U0	0.320	0.369	3.691E-20	350	0.391	0.451	C9J2U0.pdb.gz	C9J2U0_HUMAN Cyclin E variant ex7del OS=Homo sapiens OX=9606 GN=CCNE1 PE=1 SV=3
6	AFDB:O01501	0.616	0.479	4.028E-19	524	0.260	0.200	O01501.pdb.gz	CCNE_CAEEL G1/S-specific cyclin-E OS=Caenorhabditis elegans OX=6239 GN=cye-1 PE=1 SV=2
7	AFDB:P20248	0.488	0.458	1.932E-13	432	0.203	0.190	P20248.pdb.gz	CCNA2_HUMAN Cyclin-A2 OS=Homo sapiens OX=9606 GN=CCNA2 PE=1 SV=2
8	AFDB:Q6NV43	0.504	0.476	2.299E-13	428	0.215	0.203	Q6NV43.pdb.gz	Q6NV43_DANRE Cyclin-A2 OS=Danio rerio OX=7955 GN=chunp6924 PE=2 SV=2
9	AFDB:Q61456	0.512	0.492	3.873E-13	421	0.215	0.207	Q61456.pdb.gz	CCNA1_MOUSE Cyclin-A1 OS=Mus musculus OX=10090 GN=Ccna1 PE=1 SV=2
10	AFDB:Q39068	0.511	0.483	4.813E-13	429	0.191	0.179	Q39068.pdb.gz	CCB21_ARATH Cyclin-B2-1 OS=Arabidopsis thaliana OX=3702 GN=CYCB2-1 PE=1 SV=2
11	PDB:2w96A	0.442	0.695	1.654E-9	249	0.153	0.249	2w96A.pdb.gz
12	PDB:7nj0C	0.509	0.741	6.941E-9	270	0.166	0.248	7nj0C.pdb.gz	Structural basis of human separase regulation by securin and CDK1-cyclin B1.
13	PDB:7b5lY	0.488	0.762	7.571E-9	253	0.146	0.233	7b5lY.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
14	PDB:1g3nC	0.477	0.799	1.729E-8	233	0.114	0.197	1g3nC.pdb.gz
15	PDB:3g33B	0.479	0.815	1.886E-8	229	0.141	0.249	3g33B.pdb.gz
16	PDB:7egb9	0.345	0.467	7.934E-4	287	0.124	0.174	7egb9.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
17	PDB:1zp2A	0.344	0.579	1.076E-3	227	0.077	0.137	1zp2A.pdb.gz
18	PDB:5hbhB	0.361	0.520	1.590E-3	270	0.097	0.144	5hbhB.pdb.gz	Discovery of Potent, Selective, and Orally Bioavailable Small-Molecule Modulators of the Mediator Complex-Associated Kinases CDK8 and CDK19.
19	PDB:7kpvB	0.359	0.485	1.590E-3	290	0.097	0.134	7kpvB.pdb.gz
20	PDB:7kueB	0.348	0.576	2.565E-3	225	0.092	0.164	7kueB.pdb.gz	Structure of TFIIK for phosphorylation of CTD of RNA polymerase II.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A291	0.0	747	404	0.926	0.926	A0A8I6A291_RAT Cyclin E2 OS=Rattus norvegicus OX=10116 GN=Ccne2 PE=3 SV=1
2	D3ZQ41	0.0	753	405	0.928	0.926	D3ZQ41_RAT Cyclin E2 OS=Rattus norvegicus OX=10116 GN=Ccne2 PE=3 SV=1
3	O96020	0.0	839	404	1.000	1.000	CCNE2_HUMAN G1/S-specific cyclin-E2 OS=Homo sapiens OX=9606 GN=CCNE2 PE=1 SV=1
4	Q9Z238	0.0	761	404	0.923	0.923	CCNE2_MOUSE G1/S-specific cyclin-E2 OS=Mus musculus OX=10090 GN=Ccne2 PE=1 SV=1
5	P47794	7.92e-128	376	410	0.485	0.478	CCNE1_DANRE G1/S-specific cyclin-E1 OS=Danio rerio OX=7955 GN=ccne1 PE=2 SV=1
6	P24864	1.50e-125	370	410	0.458	0.451	CCNE1_HUMAN G1/S-specific cyclin-E1 OS=Homo sapiens OX=9606 GN=CCNE1 PE=1 SV=2
7	P39949	4.50e-125	369	411	0.446	0.438	CCNE1_RAT G1/S-specific cyclin-E1 OS=Rattus norvegicus OX=10116 GN=Ccne1 PE=1 SV=2
8	Q61457	4.47e-124	366	408	0.446	0.441	CCNE1_MOUSE G1/S-specific cyclin-E1 OS=Mus musculus OX=10090 GN=Ccne1 PE=1 SV=2
9	C9J2U0	6.01e-95	290	350	0.389	0.449	C9J2U0_HUMAN Cyclin E variant ex7del OS=Homo sapiens OX=9606 GN=CCNE1 PE=1 SV=3
10	P54733	6.61e-79	259	709	0.339	0.193	CCNE_DROME G1/S-specific cyclin-E OS=Drosophila melanogaster OX=7227 GN=CycE PE=1 SV=2
11	I3L1Q9	8.74e-54	179	215	0.228	0.428	I3L1Q9_HUMAN Cyclin E1 (Fragment) OS=Homo sapiens OX=9606 GN=CCNE1 PE=1 SV=8
12	O01501	2.09e-41	155	524	0.210	0.162	CCNE_CAEEL G1/S-specific cyclin-E OS=Caenorhabditis elegans OX=6239 GN=cye-1 PE=1 SV=2
13	Q9C6A9	1.21e-27	114	372	0.171	0.185	CCA32_ARATH Cyclin-A3-2 OS=Arabidopsis thaliana OX=3702 GN=CYCA3-2 PE=2 SV=1
14	Q9FMH5	2.58e-26	110	355	0.149	0.169	CCA31_ARATH Putative cyclin-A3-1 OS=Arabidopsis thaliana OX=3702 GN=CYCA3-1 PE=3 SV=1
15	Q3ECW2	1.20e-25	108	370	0.139	0.151	CCA34_ARATH Cyclin-A3-4 OS=Arabidopsis thaliana OX=3702 GN=CYCA3-4 PE=1 SV=1
16	P14785	5.59e-25	108	491	0.126	0.104	CCNA_DROME G2/mitotic-specific cyclin-A OS=Drosophila melanogaster OX=7227 GN=CycA PE=1 SV=3
17	Q9FVX0	2.28e-24	106	442	0.141	0.129	CCA12_ARATH Cyclin-A1-2 OS=Arabidopsis thaliana OX=3702 GN=CYCA1-2 PE=1 SV=2
18	P43449	3.17e-24	105	395	0.124	0.127	CCNA2_CHICK Cyclin-A2 OS=Gallus gallus OX=9031 GN=CCNA2 PE=1 SV=1
19	A0MEB5	4.02e-24	103	327	0.139	0.171	CCA33_ARATH Cyclin-A3-3 OS=Arabidopsis thaliana OX=3702 GN=CYCA3-3 PE=2 SV=2
20	A0A0G2JVY9	4.23e-24	105	418	0.121	0.117	A0A0G2JVY9_RAT Cyclin-A2 OS=Rattus norvegicus OX=10116 GN=Ccna2 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02984 Cyclin_C	3.9e-14	64.2	Cyclin, C-terminal domain
2	PF00134 Cyclin_N	5.4e-37	137.8	Cyclin, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000429089

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000266970	0.999	Cyclin-dependent kinase 2
2	9606.ENSP00000384849	0.996	Cyclin-dependent kinase inhibitor 1
3	9606.ENSP00000378699	0.995	Cyclin-dependent kinase 1
4	9606.ENSP00000228872	0.994	Cyclin-dependent kinase inhibitor 1B
5	9606.ENSP00000209728	0.989	Cell division control protein 6 homolog
6	9606.ENSP00000257904	0.985	Cyclin-dependent kinase 4
7	9606.ENSP00000303706	0.982	M-phase inducer phosphatase 1
8	9606.ENSP00000262904	0.977	Transcription factor E2F3
9	9606.ENSP00000355249	0.977	Transcription factor E2F2
10	9606.ENSP00000400088	0.972	TEN1-CDK3 readthrough (NMD candidate)
11	9606.ENSP00000413720	0.971	Cyclin-dependent kinase inhibitor 1C
12	9606.ENSP00000265734	0.966	Cyclin-dependent kinase 6
13	9606.ENSP00000274026	0.966	Cyclin-A2
14	9606.ENSP00000345571	0.966	Transcription factor E2F1
15	9606.ENSP00000368458	0.959	Proliferating cell nuclear antigen
16	9606.ENSP00000362768	0.958	Retinoblastoma-like protein 1
17	9606.ENSP00000402084	0.958	Wee1-like protein kinase
18	9606.ENSP00000256443	0.953	Cyclin-dependent kinase 7
19	9606.ENSP00000255465	0.949	Cyclin-A1
20	9606.ENSP00000262133	0.948	Retinoblastoma-like protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019901	0.999	protein kinase binding
GO:0016538	0.489	cyclin-dependent protein serine/threonine kinase regulator activity
GO:0003824	0.351	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0009987	0.991	cellular process
GO:0019222	0.985	regulation of metabolic process
GO:0051726	0.980	regulation of cell cycle
GO:0031323	0.975	regulation of cellular metabolic process
GO:0044238	0.973	primary metabolic process
GO:0060255	0.968	regulation of macromolecule metabolic process
GO:0080090	0.964	regulation of primary metabolic process
GO:0051171	0.964	regulation of nitrogen compound metabolic process
GO:0071704	0.955	organic substance metabolic process
GO:0051338	0.954	regulation of transferase activity
GO:0006807	0.948	nitrogen compound metabolic process
GO:0022402	0.947	cell cycle process
GO:0044237	0.933	cellular metabolic process
GO:0071900	0.931	regulation of protein serine/threonine kinase activity
GO:1904029	0.905	regulation of cyclin-dependent protein kinase activity
GO:0000079	0.904	regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0071840	0.847	cellular component organization or biogenesis
GO:0016043	0.836	cellular component organization
GO:0046483	0.818	heterocycle metabolic process
GO:0044260	0.812	cellular macromolecule metabolic process
GO:0034641	0.798	cellular nitrogen compound metabolic process
GO:0006139	0.755	nucleobase-containing compound metabolic process
GO:0090304	0.753	nucleic acid metabolic process
GO:0006259	0.741	DNA metabolic process
GO:0006996	0.735	organelle organization
GO:0048518	0.695	positive regulation of biological process
GO:0022414	0.670	reproductive process
GO:0048522	0.609	positive regulation of cellular process
GO:0051276	0.555	chromosome organization
GO:0050896	0.475	response to stimulus
GO:0006260	0.385	DNA replication
GO:0000278	0.383	mitotic cell cycle
GO:0051716	0.359	cellular response to stimulus
GO:1903047	0.355	mitotic cell cycle process
GO:0048519	0.352	negative regulation of biological process
GO:0019219	0.347	regulation of nucleobase-containing compound metabolic process
GO:0010564	0.345	regulation of cell cycle process
GO:0048523	0.333	negative regulation of cellular process
GO:0009893	0.328	positive regulation of metabolic process
GO:0010604	0.318	positive regulation of macromolecule metabolic process
GO:0048285	0.314	organelle fission
GO:0051173	0.311	positive regulation of nitrogen compound metabolic process
GO:0061982	0.311	meiosis I cell cycle process
GO:0031325	0.308	positive regulation of cellular metabolic process
GO:0007059	0.300	chromosome segregation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005829	0.994	cytosol
GO:0032991	0.985	protein-containing complex
GO:0043232	0.908	intracellular non-membrane-bounded organelle
GO:1902494	0.800	catalytic complex
GO:1990234	0.790	transferase complex
GO:0000307	0.419	cyclin-dependent protein kinase holoenzyme complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]