StarFunc result for job id O96024

User Input

>input (378 residues)
MQLRLFRRLLLAALLLVIVWTLFGPSGLGEELLSLSLASLLPAPASPGPPLALPRLLIPN
QEACSGPGAPPFLLILVCTAPENLNQRNAIRASWGGLREARGLRVQTLFLLGEPNAQHPV
WGSQGSDLASESAAQGDILQAAFQDSYRNLTLKTLSGLNWAEKHCPMARYVLKTDDDVYV
NVPELVSELVLRGGRWGQWERSTEPQREAEQEGGQVLHSEEVPLLYLGRVHWRVNPSRTP
GGRHRVSEEQWPHTWGPFPPYASGTGYVLSASAVQLILKVASRAPLLPLEDVFVGVSARR
GGLAPTQCVKLAGATHYPLDRCCYGKFLLTSHRLDPWKMQEAWKLVGGSDGERTAPFCSW
FQGVLGILRCRAIAWLQS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O96024	1.000	1.000	4.760E-85	378	1.000	1.000	O96024.pdb.gz	B3GT4_HUMAN Beta-1,3-galactosyltransferase 4 OS=Homo sapiens OX=9606 GN=B3GALT4 PE=1 SV=1
2	AFDB:Q6ZMB0	0.639	0.629	1.113E-28	384	0.254	0.250	Q6ZMB0.pdb.gz	B3GN6_HUMAN Acetylgalactosaminyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT6 PE=1 SV=2
3	AFDB:Q9BYG0	0.661	0.661	5.205E-28	378	0.286	0.286	Q9BYG0.pdb.gz	B3GN5_HUMAN Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT5 PE=1 SV=1
4	AFDB:Q9Y2C3	0.653	0.787	8.526E-28	310	0.259	0.316	Q9Y2C3.pdb.gz	B3GT5_HUMAN Beta-1,3-galactosyltransferase 5 OS=Homo sapiens OX=9606 GN=B3GALT5 PE=1 SV=1
5	AFDB:Q9C0J1	0.601	0.601	1.161E-27	378	0.286	0.286	Q9C0J1.pdb.gz	B3GN4_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 4 OS=Homo sapiens OX=9606 GN=B3GNT4 PE=1 SV=1
6	AFDB:Q9JI67	0.643	0.782	2.753E-27	308	0.251	0.308	Q9JI67.pdb.gz	B3GT5_MOUSE Beta-1,3-galactosyltransferase 5 OS=Mus musculus OX=10090 GN=B3galt5 PE=2 SV=1
7	AFDB:O54904	0.620	0.716	3.523E-27	326	0.262	0.304	O54904.pdb.gz	B3GT1_MOUSE Beta-1,3-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B3galt1 PE=1 SV=2
8	AFDB:Q99NB2	0.659	0.661	1.006E-26	377	0.265	0.265	Q99NB2.pdb.gz	B3GN5_RAT Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Rattus norvegicus OX=10116 GN=B3gnt5 PE=2 SV=2
9	AFDB:Q9Y2A9	0.636	0.646	1.210E-26	372	0.230	0.234	Q9Y2A9.pdb.gz	B3GN3_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3 OS=Homo sapiens OX=9606 GN=B3GNT3 PE=1 SV=2
10	AFDB:O43825	0.641	0.576	1.752E-26	422	0.235	0.211	O43825.pdb.gz	B3GT2_HUMAN Beta-1,3-galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GALT2 PE=1 SV=1
11	PDB:7jhiC	0.621	0.705	1.977E-25	331	0.201	0.230	7jhiC.pdb.gz	Structures and mechanism of human glycosyltransferase beta 1,3-N-acetylglucosaminyltransferase 2 (B3GNT2), an important player in immune homeostasis.
12	PDB:6fxrA	0.322	0.191	1.146E-4	700	0.077	0.041	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.
13	PDB:4fixA	0.339	0.218	1.877E-4	629	0.077	0.046	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.
14	PDB:4y63A	0.329	0.427	2.891E-4	282	0.098	0.131	4y63A.pdb.gz	Design of Glycosyltransferase Inhibitors: Serine Analogues as Pyrophosphate Surrogates?
15	PDB:5vcmB	0.258	0.270	3.479E-4	358	0.132	0.140	5vcmB.pdb.gz	HumanN-acetylglucosaminyltransferase II substrate recognition uses a modular architecture that includes a convergent exosite.
16	PDB:3r2wC	0.255	0.220	3.700E-4	450	0.069	0.058	3r2wC.pdb.gz
17	PDB:1ll0B	0.306	0.399	6.447E-4	267	0.108	0.154	1ll0B.pdb.gz
18	PDB:7d72A	0.243	0.229	1.123E-3	407	0.077	0.071	7d72A.pdb.gz	Cryo-EM structures of human GMPPA-GMPPB complex reveal how cells maintain GDP-mannose homeostasis.
19	PDB:8cvzI	0.265	0.349	1.195E-3	267	0.079	0.112	8cvzI.pdb.gz
20	PDB:2gamC	0.356	0.359	1.352E-3	374	0.098	0.099	2gamC.pdb.gz	X-ray Crystal Structure of Leukocyte Type Core 2 beta1,6-N-Acetylglucosaminyltransferase: Evidence for a covergence of metal ion independent glycosyltransferase mechanism.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O96024	0.0	759	378	1.000	1.000	B3GT4_HUMAN Beta-1,3-galactosyltransferase 4 OS=Homo sapiens OX=9606 GN=B3GALT4 PE=1 SV=1
2	Q9Y2C3	3.29e-43	154	310	0.233	0.284	B3GT5_HUMAN Beta-1,3-galactosyltransferase 5 OS=Homo sapiens OX=9606 GN=B3GALT5 PE=1 SV=1
3	O54904	1.01e-40	148	326	0.246	0.285	B3GT1_MOUSE Beta-1,3-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B3galt1 PE=1 SV=2
4	Q9Y5Z6	1.01e-40	148	326	0.246	0.285	B3GT1_HUMAN Beta-1,3-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=B3GALT1 PE=1 SV=1
5	Q9BYG0	1.22e-38	144	378	0.286	0.286	B3GN5_HUMAN Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT5 PE=1 SV=1
6	Q9JI67	3.13e-37	138	308	0.265	0.325	B3GT5_MOUSE Beta-1,3-galactosyltransferase 5 OS=Mus musculus OX=10090 GN=B3galt5 PE=2 SV=1
7	Q99NB2	1.38e-33	130	377	0.275	0.276	B3GN5_RAT Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Rattus norvegicus OX=10116 GN=B3gnt5 PE=2 SV=2
8	Q6ZMB0	1.68e-33	130	384	0.251	0.247	B3GN6_HUMAN Acetylgalactosaminyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT6 PE=1 SV=2
9	Q9C0J1	4.13e-32	126	378	0.254	0.254	B3GN4_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 4 OS=Homo sapiens OX=9606 GN=B3GNT4 PE=1 SV=1
10	Q8BGY6	8.20e-31	122	376	0.241	0.242	B3GN5_MOUSE Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Mus musculus OX=10090 GN=B3gnt5 PE=2 SV=1
11	Q920V1	8.33e-31	122	331	0.204	0.233	B3GL1_MOUSE UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1 OS=Mus musculus OX=10090 GN=B3galnt1 PE=2 SV=2
12	O43825	1.84e-29	120	422	0.225	0.201	B3GT2_HUMAN Beta-1,3-galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GALT2 PE=1 SV=1
13	O75752	2.65e-29	117	331	0.196	0.224	B3GL1_HUMAN UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=B3GALNT1 PE=1 SV=1
14	O54905	2.76e-29	119	422	0.225	0.201	B3GT2_MOUSE Beta-1,3-galactosyltransferase 2 OS=Mus musculus OX=10090 GN=B3galt2 PE=1 SV=2
15	Q9Y2A9	1.58e-28	116	372	0.225	0.228	B3GN3_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3 OS=Homo sapiens OX=9606 GN=B3GNT3 PE=1 SV=2
16	Q8K0J2	9.64e-28	114	397	0.233	0.222	B3GN7_MOUSE UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Mus musculus OX=10090 GN=B3gnt7 PE=2 SV=2
17	Q8NFL0	1.99e-26	111	401	0.230	0.217	B3GN7_HUMAN UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Homo sapiens OX=9606 GN=B3GNT7 PE=1 SV=1
18	Q24157	1.58e-25	107	325	0.212	0.246	BRN_DROME Beta-1,3-galactosyltransferase brn OS=Drosophila melanogaster OX=7227 GN=brn PE=2 SV=2
19	Q9NY97	2.20e-25	108	397	0.212	0.202	B3GN2_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GNT2 PE=1 SV=2
20	Q9Z222	5.29e-25	107	397	0.217	0.207	B3GN2_MOUSE N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 OS=Mus musculus OX=10090 GN=B3GNT2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01762 Galactosyl_T	9.7e-46	167.6	Galactosyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000390784

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000341562	0.982	Beta-1,4 N-acetylgalactosaminyltransferase 1
2	9606.ENSP00000377257	0.977	CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2
3	9606.ENSP00000262915	0.950	ST3 beta-galactoside alpha-2,3-sialyltransferase 3
4	9606.ENSP00000428540	0.938	CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1
5	9606.ENSP00000261416	0.903	Beta-hexosaminidase subunit beta
6	9606.ENSP00000268097	0.903	Beta-hexosaminidase subunit alpha
7	9606.ENSP00000306920	0.826	Beta-galactosidase
8	9606.ENSP00000306459	0.777	Beta-1,4-galactosyltransferase 6
9	9606.ENSP00000363746	0.768	WD repeat-containing protein 46
10	9606.ENSP00000384794	0.764	Lactosylceramide 4-alpha-galactosyltransferase
11	9606.ENSP00000277540	0.720	Diphthine methyltransferase
12	9606.ENSP00000363397	0.689	Ceramide glucosyltransferase
13	9606.ENSP00000393241	0.647	40S ribosomal protein S18
14	9606.ENSP00000238714	0.643	Poly(A) polymerase gamma
15	9606.ENSP00000360776	0.638	Beta-1,4-galactosyltransferase 5
16	9606.ENSP00000255108	0.632	2-(3-amino-3-carboxypropyl)histidine synthase subunit 2
17	9606.ENSP00000366549	0.632	Lactosylceramide alpha-2,3-sialyltransferase
18	9606.ENSP00000328277	0.611	N-acetyl-beta-glucosaminyl-glycoprotein 4-beta-N-acetylgalactosaminyltransferase 1
19	9606.ENSP00000385083	0.605	3-ketodihydrosphingosine reductase
20	9606.ENSP00000274853	0.601	Phostensin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0048531	1.000	beta-1,3-galactosyltransferase activity
GO:0035250	1.000	UDP-galactosyltransferase activity
GO:0008499	0.976	UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase activity
GO:0005515	0.555	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:0044237	0.998	cellular metabolic process
GO:1901564	0.997	organonitrogen compound metabolic process
GO:1901576	0.996	organic substance biosynthetic process
GO:0006672	0.991	ceramide metabolic process
GO:0043604	0.989	amide biosynthetic process
GO:0006688	0.988	glycosphingolipid biosynthetic process
GO:0046513	0.980	ceramide biosynthetic process
GO:0009311	0.953	oligosaccharide metabolic process
GO:0009312	0.939	oligosaccharide biosynthetic process
GO:0043170	0.526	macromolecule metabolic process
GO:0019538	0.466	protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	1.000	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.

[back to server]