StarFunc result for job id O96028

User Input

>input (1365 residues)
MEFSIKQSPLSVQSVVKCIKMKQAPEILGSANGKTPSCEVNRECSVFLSKAQLSSSLQEG
VMQKFNGHDALPFIPADKLKDLTSRVFNGEPGAHDAKLRFESQEMKGIGTPPNTTPIKNG
SPEIKLKITKTYMNGKPLFESSICGDSAADVSQSEENGQKPENKARRNRKRSIKYDSLLE
QGLVEAALVSKISSPSDKKIPAKKESCPNTGRDKDHLLKYNVGDLVWSKVSGYPWWPCMV
SADPLLHSYTKLKGQKKSARQYHVQFFGDAPERAWIFEKSLVAFEGEGQFEKLCQESAKQ
APTKAEKIKLLKPISGKLRAQWEMGIVQAEEAASMSVEERKAKFTFLYVGDQLHLNPQVA
KEAGIAAESLGEMAESSGVSEEAAENPKSVREECIPMKRRRRAKLCSSAETLESHPDIGK
STPQKTAEADPRRGVGSPPGRKKTTVSMPRSRKGDAASQFLVFCQKHRDEVVAEHPDASG
EEIEELLRSQWSLLSEKQRARYNTKFALVAPVQAEEDSGNVNGKKRNHTKRIQDPTEDAE
AEDTPRKRLRTDKHSLRKRDTITDKTARTSSYKAMEAASSLKSQAATKNLSDACKPLKKR
NRASTAASSALGFSKSSSPSASLTENEVSDSPGDEPSESPYESADETQTEVSVSSKKSER
GVTAKKEYVCQLCEKPGSLLLCEGPCCGAFHLACLGLSRRPEGRFTCSECASGIHSCFVC
KESKTDVKRCVVTQCGKFYHEACVKKYPLTVFESRGFRCPLHSCVSCHASNPSNPRPSKG
KMMRCVRCPVAYHSGDACLAAGCSVIASNSIICTAHFTARKGKRHHAHVNVSWCFVCSKG
GSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCH
PKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKN
ALQEAEARFREIKLQREARETQESERKPPPYKHIKVNKPYGKVQIYTADISEIPKCNCKP
TDENPCGFDSECLNRMLMFECHPQVCPAGEFCQNQCFTKRQYPETKIIKTDGKGWGLVAK
RDIRKGEFVNEYVGELIDEEECMARIKHAHENDITHFYMLTIDKDRIIDAGPKGNYSRFM
NHSCQPNCETLKWTVNGDTRVGLFAVCDIPAGTELTFNYNLDCLGNEKTVCRCGASNCSG
FLGDRPKTSTTLSSEEKGKKTKKKTRRRRAKGEGKRQSEDECFRCGDGGQLVLCDRKFCT
KAYHLSCLGLGKRPFGKWECPWHHCDVCGKPSTSFCHLCPNSFCKEHQDGTAFSCTPDGR
SYCCEHDLGAASVRSTKTEKPPPEPGKPKGKRRRRRGWRRVTEGK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O96028	1.000	1.000	0.000	1365	1.000	1.000	O96028.pdb.gz	NSD2_HUMAN Histone-lysine N-methyltransferase NSD2 OS=Homo sapiens OX=9606 GN=NSD2 PE=1 SV=1
2	AFDB:O88491	0.310	0.182	1.928E-103	2588	0.413	0.218	O88491.pdb.gz	NSD1_MOUSE Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Mus musculus OX=10090 GN=Nsd1 PE=1 SV=1
3	AFDB:Q2LAE1	0.163	0.129	1.584E-25	1759	0.186	0.144	Q2LAE1.pdb.gz	ASHH2_ARATH Histone-lysine N-methyltransferase ASHH2 OS=Arabidopsis thaliana OX=3702 GN=ASHH2 PE=1 SV=1
4	AFDB:Q9VW15	0.161	0.100	1.292E-22	2226	0.163	0.100	Q9VW15.pdb.gz	ASH1_DROME Histone-lysine N-methyltransferase ash1 OS=Drosophila melanogaster OX=7227 GN=ash1 PE=1 SV=3
5	AFDB:Q9VYD1	0.159	0.096	4.350E-21	2313	0.168	0.099	Q9VYD1.pdb.gz	C1716_DROME Probable histone-lysine N-methyltransferase CG1716 OS=Drosophila melanogaster OX=7227 GN=Set2 PE=1 SV=2
6	AFDB:E9Q5F9	0.155	0.086	1.727E-19	2537	0.160	0.086	E9Q5F9.pdb.gz	SETD2_MOUSE Histone-lysine N-methyltransferase SETD2 OS=Mus musculus OX=10090 GN=Setd2 PE=1 SV=1
7	PDB:7td5A	0.115	0.305	1.264E-14	497	0.045	0.125	7td5A.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
8	PDB:7td5F	0.116	0.339	2.190E-14	447	0.045	0.139	7td5F.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
9	PDB:5hynA	0.118	0.270	2.445E-14	581	0.042	0.100	5hynA.pdb.gz	Structural basis of oncogenic histone H3K27M inhibition of human polycomb repressive complex 2.
10	AFDB:Q8IE95	0.164	0.092	4.271E-14	2548	0.155	0.083	Q8IE95.pdb.gz	SETVS_PLAF7 Variant-silencing SET domain-containing protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=SETVS PE=2 SV=1
11	PDB:5wg6A	0.110	0.281	5.276E-14	517	0.038	0.101	5wg6A.pdb.gz	An Evolutionarily Conserved Structural Platform for PRC2 Inhibition by a Class of Ezh2 Inhibitors.
12	PDB:7ksoA	0.114	0.383	1.203E-13	395	0.042	0.147	7ksoA.pdb.gz	Structures of monomeric and dimeric PRC2:EZH1 reveal flexible modules involved in chromatin compaction.
13	PDB:6wkrC	0.116	0.255	2.326E-13	606	0.042	0.094	6wkrC.pdb.gz	JARID2 and AEBP2 regulate PRC2 in the presence of H2AK119ub1 and other histone modifications.
14	PDB:1pegA	0.131	0.595	1.025E-12	266	0.049	0.252	1pegA.pdb.gz	Structural basis for the product specificity of histone lysine methyltransferases
15	AFDB:Q8IRW8	0.131	0.081	6.033E-11	2431	0.160	0.090	Q8IRW8.pdb.gz	TRR_DROME Histone-lysine N-methyltransferase trr OS=Drosophila melanogaster OX=7227 GN=trr PE=1 SV=2
16	AFDB:O44757	0.138	0.144	2.810E-10	1312	0.119	0.123	O44757.pdb.gz	LIN59_CAEEL Probable histone-lysine N-methyltransferase lin-59 OS=Caenorhabditis elegans OX=6239 GN=lin-59 PE=2 SV=1
17	AFDB:A2ABF9	0.143	0.153	5.434E-10	1267	0.149	0.160	A2ABF9.pdb.gz	A2ABF9_HUMAN Euchromatic histone lysine methyltransferase 2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=1
18	PDB:2g46A	0.071	0.679	3.977E-5	119	0.018	0.202	2g46A.pdb.gz	Structural insights of the specificity and catalysis of a viral histone H3 lysine 27 methyltransferase.
19	PDB:5h6zA	0.072	0.661	3.977E-5	123	0.015	0.171	5h6zA.pdb.gz
20	PDB:3qxyA	0.068	0.202	9.631E-4	420	0.016	0.052	3qxyA.pdb.gz	Structural basis of SETD6-mediated regulation of the NF-kB network via methyl-lysine signaling.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B8JIA4	0.0	1080	1461	0.380	0.355	B8JIA4_DANRE Histone-lysine N-methyltransferase NSD2 OS=Danio rerio OX=7955 GN=fc12c04 PE=1 SV=1
2	D6R9V2	0.0	801	392	0.287	1.000	D6R9V2_HUMAN Nuclear receptor binding SET domain protein 2 (Fragment) OS=Homo sapiens OX=9606 GN=NSD2 PE=1 SV=1
3	O88491	0.0	1043	2588	0.333	0.176	NSD1_MOUSE Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Mus musculus OX=10090 GN=Nsd1 PE=1 SV=1
4	O96028	0.0	2835	1365	1.000	1.000	NSD2_HUMAN Histone-lysine N-methyltransferase NSD2 OS=Homo sapiens OX=9606 GN=NSD2 PE=1 SV=1
5	Q6P2L6	0.0	1117	1439	0.442	0.419	NSD3_MOUSE Histone-lysine N-methyltransferase NSD3 OS=Mus musculus OX=10090 GN=Nsd3 PE=1 SV=2
6	Q8BVE8	0.0	2511	1365	0.909	0.909	NSD2_MOUSE Histone-lysine N-methyltransferase NSD2 OS=Mus musculus OX=10090 GN=Nsd2 PE=1 SV=2
7	Q96L73	0.0	1036	2696	0.332	0.168	NSD1_HUMAN Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Homo sapiens OX=9606 GN=NSD1 PE=1 SV=1
8	Q9BZ95	0.0	1148	1437	0.452	0.429	NSD3_HUMAN Histone-lysine N-methyltransferase NSD3 OS=Homo sapiens OX=9606 GN=NSD3 PE=1 SV=1
9	D6RIS1	6.23e-132	405	199	0.146	1.000	D6RIS1_HUMAN Nuclear receptor binding SET domain protein 2 (Fragment) OS=Homo sapiens OX=9606 GN=NSD2 PE=1 SV=1
10	Q8MT36	1.43e-126	429	1427	0.181	0.173	NSD_DROME Nuclear receptor binding SET domain protein OS=Drosophila melanogaster OX=7227 GN=NSD PE=1 SV=2
11	A0A8I6AUV5	3.53e-52	205	2426	0.080	0.045	A0A8I6AUV5_RAT [histone H3]-lysine(36) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Setd2 PE=1 SV=1
12	A0A8I5ZLS2	3.84e-52	204	2419	0.080	0.045	A0A8I5ZLS2_RAT [histone H3]-lysine(36) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Setd2 PE=1 SV=1
13	A0A8I6A709	3.90e-52	204	2520	0.080	0.043	A0A8I6A709_RAT [histone H3]-lysine(36) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Setd2 PE=1 SV=1
14	A0A8I6A5I9	4.00e-52	204	2526	0.080	0.043	A0A8I6A5I9_RAT [histone H3]-lysine(36) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Setd2 PE=1 SV=1
15	A0A0G2KB10	4.58e-52	204	2523	0.080	0.043	A0A0G2KB10_RAT [histone H3]-lysine(36) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Setd2 PE=1 SV=1
16	E9Q5F9	4.88e-52	204	2537	0.080	0.043	SETD2_MOUSE Histone-lysine N-methyltransferase SETD2 OS=Mus musculus OX=10090 GN=Setd2 PE=1 SV=1
17	D4A5H6	5.09e-52	204	2294	0.080	0.048	D4A5H6_RAT [histone H3]-lysine(36) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Setd2 PE=1 SV=2
18	Q55FF7	6.38e-52	201	898	0.070	0.107	Q55FF7_DICDI SET domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0268132 PE=4 SV=1
19	Q9BYW2	7.39e-52	204	2564	0.080	0.043	SETD2_HUMAN Histone-lysine N-methyltransferase SETD2 OS=Homo sapiens OX=9606 GN=SETD2 PE=1 SV=3
20	Q2LAE1	1.19e-48	193	1759	0.069	0.053	ASHH2_ARATH Histone-lysine N-methyltransferase ASHH2 OS=Arabidopsis thaliana OX=3702 GN=ASHH2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17907 AWS	3.6e-12	57.4	AWS domain
2	PF17982 C5HCH	3.5e-09	48.0	NSD Cys-His rich domain
3	PF00505 HMG_box	3e-06	38.8	HMG (high mobility group) box
4	PF09011 HMG_box_2	0.48	22.3	HMG-box domain
5	PF00628 PHD	5e-09	47.2	PHD-finger
6	PF00855 PWWP	3.2e-37	138.3	PWWP domain
7	PF00856 SET	5.5e-18	77.4	SET domain
8	PF13771 zf-HC5HC2H	67	15.1	PHD-like zinc-binding domain
9	PF13832 zf-HC5HC2H_2	73	15.0	PHD-zinc-finger like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000372351

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362649	0.990	Histone deacetylase 1
2	9606.ENSP00000365588	0.981	Mediator of DNA damage checkpoint protein 1
3	9606.ENSP00000263377	0.965	Bromodomain-containing protein 4
4	9606.ENSP00000244537	0.949	Histone cluster 1 H4 family member f
5	9606.ENSP00000327758	0.930	Homeobox protein Nkx-2.5
6	9606.ENSP00000388107	0.922	Ubiquitin-60S ribosomal protein L40
7	9606.ENSP00000371475	0.916	TP53-binding protein 1
8	9606.ENSP00000348056	0.914	SUMO-conjugating enzyme UBC9
9	9606.ENSP00000304697	0.913	Polyubiquitin-B
10	9606.ENSP00000272317	0.912	Ubiquitin-40S ribosomal protein S27a
11	9606.ENSP00000441543	0.912	Polyubiquitin-C
12	9606.ENSP00000012443	0.908	Serine/threonine-protein phosphatase 5
13	9606.ENSP00000347168	0.905	Histone cluster 1 H4 family member j
14	9606.ENSP00000366956	0.905	Histone cluster 1 H4 family member h
15	9606.ENSP00000366974	0.905	Histone cluster 1 H4 family member b
16	9606.ENSP00000367034	0.905	Histone cluster 1 H4 family member c
17	9606.ENSP00000443017	0.905	Histone cluster 4, H4
18	9606.ENSP00000462355	0.905	Histone cluster 2 H4 family member b
19	9606.ENSP00000462667	0.905	Histone cluster 2 H4 family member a
20	9606.ENSP00000479106	0.905	Histone cluster 1 H4 family member a

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140939	0.997	histone H4 methyltransferase activity
GO:0046975	0.997	histone H3K36 methyltransferase activity
GO:0003676	0.836	nucleic acid binding
GO:0003677	0.788	DNA binding
GO:0042799	0.783	histone H4K20 methyltransferase activity
GO:0003682	0.644	chromatin binding
GO:0140110	0.537	transcription regulator activity
GO:0043565	0.512	sequence-specific DNA binding
GO:0003690	0.373	double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0071704	0.986	organic substance metabolic process
GO:0044260	0.984	cellular macromolecule metabolic process
GO:0044238	0.983	primary metabolic process
GO:0006807	0.979	nitrogen compound metabolic process
GO:0050789	0.907	regulation of biological process
GO:0050896	0.881	response to stimulus
GO:0050794	0.878	regulation of cellular process
GO:0006974	0.835	cellular response to DNA damage stimulus
GO:0019222	0.827	regulation of metabolic process
GO:0006259	0.809	DNA metabolic process
GO:0080090	0.804	regulation of primary metabolic process
GO:0051171	0.803	regulation of nitrogen compound metabolic process
GO:0060255	0.802	regulation of macromolecule metabolic process
GO:0031323	0.796	regulation of cellular metabolic process
GO:0043412	0.699	macromolecule modification
GO:0048518	0.666	positive regulation of biological process
GO:0036211	0.652	protein modification process
GO:0019219	0.642	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.592	regulation of gene expression
GO:0048519	0.556	negative regulation of biological process
GO:0048523	0.537	negative regulation of cellular process
GO:0006281	0.526	DNA repair
GO:0032259	0.494	methylation
GO:0048522	0.491	positive regulation of cellular process
GO:0006355	0.475	regulation of DNA-templated transcription
GO:0018193	0.423	peptidyl-amino acid modification
GO:0009893	0.413	positive regulation of metabolic process
GO:0051172	0.412	negative regulation of nitrogen compound metabolic process
GO:0043414	0.412	macromolecule methylation
GO:0016570	0.412	histone modification
GO:0031324	0.411	negative regulation of cellular metabolic process
GO:0048856	0.406	anatomical structure development
GO:0018205	0.404	peptidyl-lysine modification
GO:0032501	0.398	multicellular organismal process
GO:0031325	0.386	positive regulation of cellular metabolic process
GO:0010605	0.373	negative regulation of macromolecule metabolic process
GO:0051173	0.367	positive regulation of nitrogen compound metabolic process
GO:0010604	0.366	positive regulation of macromolecule metabolic process
GO:0007275	0.359	multicellular organism development
GO:0006302	0.355	double-strand break repair
GO:0048731	0.338	system development
GO:0048583	0.337	regulation of response to stimulus
GO:0018022	0.327	peptidyl-lysine methylation
GO:0045934	0.310	negative regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0032991	0.475	protein-containing complex
GO:0043232	0.434	intracellular non-membrane-bounded organelle
GO:0005737	0.349	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:51736	1.000	L-lysyl-[protein] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl-[protein] + S-adenosyl-L-homocysteine

[back to server]