StarFunc result for job id P00156

User Input

>input (380 residues)
MTPMRKTNPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFLAMHYSPDAS
TAFSSIAHITRDVNYGWIIRYLHANGASMFFICLFLHIGRGLYYGSFLYSETWNIGIILL
LATMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTDLVQWIWGGYSVDSPTLTRFFT
FHFILPFIIAALATLHLLFLHETGSNNPLGITSHSDKITFHPYYTIKDALGLLLFLLSLM
TLTLFSPDLLGDPDNYTLANPLNTPPHIKPEWYFLFAYTILRSVPNKLGGVLALLLSILI
LAMIPILHMSKQQSMMFRPLSQSLYWLLAADLLILTWIGGQPVSYPFTIIGQVASVLYFT
TILILMPTISLIENKMLKWA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P00156	1.000	1.000	1.325E-52	380	1.000	1.000	P00156.pdb.gz	CYB_HUMAN Cytochrome b OS=Homo sapiens OX=9606 GN=MT-CYB PE=1 SV=2
2	AFDB:P00157	0.996	0.999	1.458E-47	379	0.787	0.789	P00157.pdb.gz	CYB_BOVIN Cytochrome b OS=Bos taurus OX=9913 GN=MT-CYB PE=1 SV=1
3	AFDB:P00158	0.994	0.992	7.941E-47	381	0.782	0.780	P00158.pdb.gz	CYB_MOUSE Cytochrome b OS=Mus musculus OX=10090 GN=Mt-Cyb PE=1 SV=1
4	PDB:5xteJ	0.989	0.995	1.982E-45	378	0.995	1.000	5xteJ.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
5	AFDB:P18946	0.994	0.994	6.239E-45	380	0.729	0.729	P18946.pdb.gz	CYB_CHICK Cytochrome b OS=Gallus gallus OX=9031 GN=MT-CYB PE=1 SV=1
6	PDB:7o37C	0.990	0.990	7.264E-44	380	0.779	0.779	7o37C.pdb.gz	Structure and assembly of the mammalian mitochondrial supercomplex CIII 2 CIV.
7	PDB:1be3C	0.984	0.986	3.682E-41	379	0.787	0.789	1be3C.pdb.gz	Complete structure of the 11-subunit bovine mitochondrial cytochrome bc1 complex.
8	PDB:3cwbC	0.988	0.988	8.592E-41	380	0.729	0.729	3cwbC.pdb.gz	The role of molecular modeling in the design of analogues of the fungicidal natural products crocacins A and D.
9	AFDB:P18935	0.987	0.992	1.373E-40	378	0.608	0.611	P18935.pdb.gz	CYB_DROME Cytochrome b OS=Drosophila melanogaster OX=7227 GN=mt:Cyt-b PE=3 SV=2
10	AFDB:P05501	0.987	0.969	6.382E-35	387	0.497	0.488	P05501.pdb.gz	CYB_SCHPO Cytochrome b OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cob PE=3 SV=4
11	AFDB:P0C523	0.973	0.932	8.957E-35	397	0.511	0.489	P0C523.pdb.gz	CYB_ORYSI Cytochrome b OS=Oryza sativa subsp. indica OX=39946 GN=MT-CYB PE=3 SV=1
12	PDB:3cx5C	0.985	0.972	1.254E-34	385	0.492	0.486	3cx5C.pdb.gz	Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
13	AFDB:P00163	0.987	0.974	3.475E-34	385	0.492	0.486	P00163.pdb.gz	CYB_YEAST Cytochrome b OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COB PE=1 SV=3
14	AFDB:P03879	0.658	0.394	2.638E-21	638	0.358	0.213	P03879.pdb.gz	MBI4_YEAST Intron-encoded RNA maturase bI4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BI4 PE=1 SV=2
15	AFDB:P9WP37	0.769	0.557	4.820E-13	549	0.208	0.144	P9WP37.pdb.gz	QCRB_MYCTU Cytochrome bc1 complex cytochrome b subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=qcrB PE=1 SV=1
16	PDB:7e1vN	0.779	0.584	1.329E-12	524	0.213	0.155	7e1vN.pdb.gz	Structure of Mycobacterium tuberculosis cytochrome bcc in complex with Q203 and TB47, two anti-TB drug candidates.
17	PDB:7r0wI	0.506	0.851	1.736E-10	222	0.174	0.297	7r0wI.pdb.gz	Cryo-EM structures of the Synechocystis sp. PCC 6803 cytochrome b6f complex with and without the regulatory PetP subunit.
18	PDB:7r0wJ	0.293	0.629	1.479E-2	159	0.097	0.233	7r0wJ.pdb.gz	Cryo-EM structures of the Synechocystis sp. PCC 6803 cytochrome b6f complex with and without the regulatory PetP subunit.
19	PDB:7yu4A	0.125	0.169	2.046E-1	266	0.087	0.124	7yu4A.pdb.gz	Structure of the active G i -coupled human lysophosphatidic acid receptor 1 complexed with a potent agonist.
20	PDB:7zh0A	0.143	0.120	2.135E-1	495	0.124	0.095	7zh0A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P00156	0.0	757	380	1.000	1.000	CYB_HUMAN Cytochrome b OS=Homo sapiens OX=9606 GN=MT-CYB PE=1 SV=2
2	P00157	0.0	589	379	0.787	0.789	CYB_BOVIN Cytochrome b OS=Bos taurus OX=9913 GN=MT-CYB PE=1 SV=1
3	P00158	0.0	601	381	0.782	0.780	CYB_MOUSE Cytochrome b OS=Mus musculus OX=10090 GN=Mt-Cyb PE=1 SV=1
4	P00159	0.0	604	380	0.784	0.784	CYB_RAT Cytochrome b OS=Rattus norvegicus OX=10116 GN=Mt-Cyb PE=3 SV=3
5	P18946	0.0	572	380	0.724	0.724	CYB_CHICK Cytochrome b OS=Gallus gallus OX=9031 GN=MT-CYB PE=1 SV=1
6	P24964	0.0	613	379	0.779	0.781	CYB_PIG Cytochrome b OS=Sus scrofa OX=9823 GN=MT-CYB PE=3 SV=2
7	P18935	3.79e-177	499	378	0.600	0.603	CYB_DROME Cytochrome b OS=Drosophila melanogaster OX=7227 GN=mt:Cyt-b PE=3 SV=2
8	P0C524	5.28e-136	395	397	0.505	0.484	CYB_ORYSJ Cytochrome b OS=Oryza sativa subsp. japonica OX=39947 GN=MT-CYB PE=2 SV=1
9	Q8HCN3	5.28e-136	395	397	0.505	0.484	Q8HCN3_ORYSJ Cytochrome b OS=Oryza sativa subsp. japonica OX=39947 GN=cob PE=3 SV=2
10	P0C523	1.37e-132	387	397	0.497	0.476	CYB_ORYSI Cytochrome b OS=Oryza sativa subsp. indica OX=39946 GN=MT-CYB PE=3 SV=1
11	P00163	3.89e-128	375	385	0.492	0.486	CYB_YEAST Cytochrome b OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COB PE=1 SV=3
12	P05501	1.18e-126	371	387	0.500	0.491	CYB_SCHPO Cytochrome b OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cob PE=3 SV=4
13	Q2F912	6.55e-126	370	397	0.482	0.461	Q2F912_ORYSJ Cytochrome b OS=Oryza sativa subsp. japonica OX=39947 GN=cob PE=3 SV=1
14	Q2F965	6.55e-126	370	397	0.482	0.461	Q2F965_ORYSI Cytochrome b OS=Oryza sativa subsp. indica OX=39946 GN=cob PE=3 SV=1
15	P03879	6.80e-90	285	638	0.358	0.213	MBI4_YEAST Intron-encoded RNA maturase bI4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BI4 PE=1 SV=2
16	Q95862	1.00e-62	198	122	0.234	0.730	Q95862_9GOBI Cytochrome b (Fragment) OS=Neogobius melanostomus OX=47308 GN=cytb PE=4 SV=1
17	Q9ZZW7	1.73e-61	207	517	0.255	0.188	MBI3_YEAST Cytochrome b mRNA maturase bI3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BI3 PE=1 SV=1
18	P03873	1.58e-44	160	423	0.213	0.191	MBI2_YEAST Cytochrome b mRNA maturase bI2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BI2 PE=1 SV=2
19	Q57038	1.48e-36	134	222	0.176	0.302	CYB6_SYNY3 Cytochrome b6 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=petB PE=1 SV=1
20	P0C315	8.60e-36	132	215	0.171	0.302	CYB6_ORYSA Cytochrome b6 OS=Oryza sativa OX=4530 GN=petB PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00033 Cytochrome_B	3.3e-79	276.6	Cytochrome b/b6/petB
2	PF00032 Cytochrom_B_C	1.1e-30	117.3	Cytochrome b(C-terminal)/b6/petD
3	PF13631 Cytochrom_B_N_2	1.1e-35	134.6	Cytochrome b(N-terminal)/b6/petB

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354554

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000306397	0.999	Cytochrome b-c1 complex subunit Rieske, mitochondrial
2	9606.ENSP00000307786	0.999	Cytochrome c
3	9606.ENSP00000317159	0.999	Cytochrome c1, heme protein, mitochondrial
4	9606.ENSP00000354499	0.999	Cytochrome c oxidase subunit 1
5	9606.ENSP00000354687	0.999	NADH-ubiquinone oxidoreductase chain 1
6	9606.ENSP00000354813	0.999	NADH-ubiquinone oxidoreductase chain 5
7	9606.ENSP00000354876	0.999	Cytochrome c oxidase subunit 2
8	9606.ENSP00000354961	0.999	NADH-ubiquinone oxidoreductase chain 4
9	9606.ENSP00000354982	0.999	Cytochrome c oxidase subunit 3
10	9606.ENSP00000355046	0.999	NADH-ubiquinone oxidoreductase chain 2
11	9606.ENSP00000367939	0.999	Cytochrome b-c1 complex subunit 8
12	9606.ENSP00000430494	0.999	Cytochrome b-c1 complex subunit 7
13	9606.ENSP00000354632	0.998	ATP synthase subunit a
14	9606.ENSP00000354728	0.998	NADH-ubiquinone oxidoreductase chain 4L
15	9606.ENSP00000355206	0.998	NADH-ubiquinone oxidoreductase chain 3
16	9606.ENSP00000309565	0.997	Cytochrome b-c1 complex subunit 6, mitochondrial
17	9606.ENSP00000354665	0.997	NADH-ubiquinone oxidoreductase chain 6
18	9606.ENSP00000268379	0.996	Cytochrome b-c1 complex subunit 2, mitochondrial
19	9606.ENSP00000332887	0.996	Cytochrome b-c1 complex subunit 9
20	9606.ENSP00000203407	0.992	Cytochrome b-c1 complex subunit 1, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0020037	1.000	heme binding
GO:0008121	0.999	ubiquinol-cytochrome-c reductase activity
GO:0005515	0.623	protein binding
GO:0048038	0.467	quinone binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0044237	0.976	cellular metabolic process
GO:0006091	0.752	generation of precursor metabolites and energy
GO:0045333	0.739	cellular respiration
GO:0009060	0.577	aerobic respiration
GO:0006119	0.532	oxidative phosphorylation
GO:0050896	0.491	response to stimulus
GO:0022904	0.423	respiratory electron transport chain
GO:0042773	0.397	ATP synthesis coupled electron transport
GO:0019646	0.383	aerobic electron transport chain
GO:0042775	0.383	mitochondrial ATP synthesis coupled electron transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0098803	1.000	respiratory chain complex
GO:0005746	1.000	mitochondrial respirasome
GO:0098800	1.000	inner mitochondrial membrane protein complex
GO:1990204	0.999	oxidoreductase complex
GO:1902495	0.998	transmembrane transporter complex
GO:0070069	0.989	cytochrome complex
GO:0045275	0.982	respiratory chain complex III
GO:0005750	0.964	mitochondrial respiratory chain complex III

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:11484	0.999	a quinol + 2 Fe(III)-[cytochrome c](out) = a quinone + 2 Fe(II)-[cytochrome c](out) + 2 H(+)(out)
EC:7.1.1.8	0.999	quinol--cytochrome-c reductase.

[back to server]