StarFunc result for job id P00352

User Input

>input (501 residues)
MSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDV
DKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYL
NDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKI
GPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDID
KVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQG
QCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIES
GKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKR
ANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGE
YGFHEYTEVKTVTVKISQKNS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P00352	1.000	1.000	0.000	501	1.000	1.000	P00352.pdb.gz	AL1A1_HUMAN Aldehyde dehydrogenase 1A1 OS=Homo sapiens OX=9606 GN=ALDH1A1 PE=1 SV=2
2	AFDB:O35945	0.995	0.995	9.108E-102	501	0.844	0.844	O35945.pdb.gz	AL1A7_MOUSE Aldehyde dehydrogenase, cytosolic 1 OS=Mus musculus OX=10090 GN=Aldh1a7 PE=1 SV=1
3	PDB:5abmA	0.982	0.996	1.432E-101	494	0.906	0.919	5abmA.pdb.gz	Structural, Biochemical, and Computational Studies Reveal the Mechanism of Selective Aldehyde Dehydrogenase 1A1 Inhibition by Cytotoxic Duocarmycin Analogues.
4	AFDB:Q28399	0.994	0.994	2.595E-100	501	0.830	0.830	Q28399.pdb.gz	ALDH1_ELEED Aldehyde dehydrogenase, cytosolic 1 OS=Elephantulus edwardii OX=28737 GN=ALDH1 PE=1 SV=1
5	PDB:7yobA	0.983	0.997	2.049E-96	494	0.862	0.874	7yobA.pdb.gz
6	PDB:1o9jA	0.981	0.995	5.136E-94	494	0.818	0.830	1o9jA.pdb.gz	Crystal Structure of Eta-Crystallin: Adaptation of a Class 1 Aldehyde Dehydrogenase for a New Role in the Eye Lens
7	AFDB:Q9DD46	0.984	0.963	1.693E-93	512	0.717	0.701	Q9DD46.pdb.gz	Q9DD46_CHICK Aldehyde dehydrogenase OS=Gallus gallus OX=9031 GN=ALDH6 PE=2 SV=1
8	AFDB:O93344	0.981	0.949	7.804E-93	518	0.707	0.683	O93344.pdb.gz	AL1A2_CHICK Retinal dehydrogenase 2 OS=Gallus gallus OX=9031 GN=ALDH1A2 PE=2 SV=2
9	AFDB:A0A286XPF7	0.989	0.951	1.580E-92	521	0.685	0.658	A0A286XPF7.pdb.gz	A0A286XPF7_CAVPO Aldehyde dehydrogenase 2 family member OS=Cavia porcellus OX=10141 GN=ALDH2 PE=3 SV=1
10	AFDB:B3DKM0	0.979	0.947	1.675E-92	518	0.713	0.689	B3DKM0.pdb.gz
11	PDB:6aljA	0.978	0.996	1.746E-92	492	0.719	0.732	6aljA.pdb.gz	Structural Basis of ALDH1A2 Inhibition by Irreversible and Reversible Small Molecule Inhibitors.
12	AFDB:P47895	0.987	0.966	2.119E-92	512	0.699	0.684	P47895.pdb.gz	AL1A3_HUMAN Retinaldehyde dehydrogenase 3 OS=Homo sapiens OX=9606 GN=ALDH1A3 PE=1 SV=2
13	AFDB:Q9CZS1	0.991	0.957	5.313E-90	519	0.653	0.630	Q9CZS1.pdb.gz	AL1B1_MOUSE Aldehyde dehydrogenase X, mitochondrial OS=Mus musculus OX=10090 GN=Aldh1b1 PE=1 SV=1
14	AFDB:A2BGR9	0.988	0.960	1.623E-89	516	0.653	0.634	A2BGR9.pdb.gz
15	PDB:4fr8C	0.978	0.988	5.747E-88	496	0.673	0.679	4fr8C.pdb.gz	Vascular Bioactivation of Nitroglycerin by Aldehyde Dehydrogenase-2: REACTION INTERMEDIATES REVEALED BY CRYSTALLOGRAPHY AND MASS SPECTROMETRY.
16	PDB:7a6qA	0.963	0.986	1.718E-85	489	0.693	0.710	7a6qA.pdb.gz	A Selective Competitive Inhibitor of Aldehyde Dehydrogenase 1A3 Hinders Cancer Cell Growth, Invasiveness and Stemness In Vitro.
17	PDB:7mjcA	0.978	0.994	2.916E-85	493	0.643	0.653	7mjcA.pdb.gz	Inhibitors targeted to aldehyde dehydrogenase
18	PDB:1zumI	0.925	0.989	4.872E-78	468	0.637	0.682	1zumI.pdb.gz
19	PDB:5fhzF	0.886	0.988	4.450E-75	449	0.655	0.731	5fhzF.pdb.gz	Crystal structure of human aldehyde dehydrogenase 1A3 complexed with NAD(+) and retinoic acid.
20	PDB:7rluA	0.940	0.809	2.211E-70	583	0.473	0.407	7rluA.pdb.gz	Structure of putative tumor suppressor ALDH1L1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A286XPF7	725	521	0.685	0.658	A0A286XPF7_CAVPO Aldehyde dehydrogenase 2 family member OS=Cavia porcellus OX=10141 GN=ALDH2 PE=3 SV=1
2	A0A384MTJ7	688	517	0.643	0.623	A0A384MTJ7_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
3	C7A2A0	571	534	0.541	0.507	BALDH_ANTMA Benzaldehyde dehydrogenase, mitochondrial OS=Antirrhinum majus OX=4151 GN=BALDH PE=1 SV=1
4	O14293	550	503	0.517	0.515	YF19_SCHPO Putative aldehyde dehydrogenase-like protein C9E9.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC9E9.09c PE=1 SV=1
5	O35945	888	501	0.844	0.844	AL1A7_MOUSE Aldehyde dehydrogenase, cytosolic 1 OS=Mus musculus OX=10090 GN=Aldh1a7 PE=1 SV=1
6	O93344	766	518	0.707	0.683	AL1A2_CHICK Retinal dehydrogenase 2 OS=Gallus gallus OX=9031 GN=ALDH1A2 PE=2 SV=2
7	O94788	779	518	0.721	0.697	AL1A2_HUMAN Retinal dehydrogenase 2 OS=Homo sapiens OX=9606 GN=ALDH1A2 PE=1 SV=3
8	P00352	1038	501	1.000	1.000	AL1A1_HUMAN Aldehyde dehydrogenase 1A1 OS=Homo sapiens OX=9606 GN=ALDH1A1 PE=1 SV=2
9	P05091	720	517	0.681	0.660	ALDH2_HUMAN Aldehyde dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH2 PE=1 SV=2
10	P08157	555	497	0.559	0.563	ALDH_EMENI Aldehyde dehydrogenase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aldA PE=3 SV=2
11	P11884	721	519	0.679	0.655	ALDH2_RAT Aldehyde dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Aldh2 PE=1 SV=1
12	P13601	872	501	0.828	0.828	AL1A7_RAT Aldehyde dehydrogenase, cytosolic 1 OS=Rattus norvegicus OX=10116 GN=Aldh1a7 PE=1 SV=2
13	P24549	929	501	0.870	0.870	AL1A1_MOUSE Aldehyde dehydrogenase 1A1 OS=Mus musculus OX=10090 GN=Aldh1a1 PE=1 SV=5
14	P30837	688	517	0.643	0.623	AL1B1_HUMAN Aldehyde dehydrogenase X, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH1B1 PE=1 SV=4
15	P47738	718	519	0.677	0.653	ALDH2_MOUSE Aldehyde dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Aldh2 PE=1 SV=1
16	P47895	749	512	0.699	0.684	AL1A3_HUMAN Retinaldehyde dehydrogenase 3 OS=Homo sapiens OX=9606 GN=ALDH1A3 PE=1 SV=2
17	P48644	972	501	0.914	0.914	AL1A1_BOVIN Aldehyde dehydrogenase 1A1 OS=Bos taurus OX=9913 GN=ALDH1A1 PE=1 SV=3
18	P51647	921	501	0.864	0.864	AL1A1_RAT Aldehyde dehydrogenase 1A1 OS=Rattus norvegicus OX=10116 GN=Aldh1a1 PE=1 SV=3
19	P51977	975	501	0.916	0.916	AL1A1_SHEEP Aldehyde dehydrogenase 1A1 OS=Ovis aries OX=9940 GN=ALDH1A1 PE=1 SV=2
20	Q28399	894	501	0.830	0.830	ALDH1_ELEED Aldehyde dehydrogenase, cytosolic 1 OS=Elephantulus edwardii OX=28737 GN=ALDH1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00171 Aldedh	2.3e-181	615.0	Aldehyde dehydrogenase family
2	PF05893 LuxC	0.21	22.2	Acyl-CoA reductase (LuxC)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000297785

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000224356	0.967	Cytochrome P450 26A1
2	9606.ENSP00000001146	0.962	Cytochrome P450 26B1
3	9606.ENSP00000285949	0.952	Cytochrome P450 26C1
4	9606.ENSP00000370750	0.951	Retinol dehydrogenase 11
5	9606.ENSP00000389241	0.948	Dehydrogenase/reductase SDR family member 9
6	9606.ENSP00000257895	0.945	11-cis retinol dehydrogenase
7	9606.ENSP00000258168	0.941	Beta,beta-carotene 15,15'-dioxygenase
8	9606.ENSP00000480439	0.941	Short-chain dehydrogenase/reductase 3
9	9606.ENSP00000449079	0.935	Retinol dehydrogenase 12
10	9606.ENSP00000369050	0.933	Cytochrome P450 1A1
11	9606.ENSP00000326219	0.931	Dehydrogenase/reductase SDR family member 4
12	9606.ENSP00000307607	0.929	Epidermal retinol dehydrogenase 2
13	9606.ENSP00000324648	0.928	Cytochrome P450 2B6
14	9606.ENSP00000337915	0.927	Cytochrome P450 3A4
15	9606.ENSP00000381206	0.926	Retinol dehydrogenase 16
16	9606.ENSP00000222982	0.922	Cytochrome P450 3A5
17	9606.ENSP00000342007	0.921	Cytochrome P450 1A2
18	9606.ENSP00000301141	0.918	Cytochrome P450 2A6
19	9606.ENSP00000308032	0.914	Cytochrome P450 2S1
20	9606.ENSP00000451406	0.913	17-beta-hydroxysteroid dehydrogenase type 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004030	1.000	aldehyde dehydrogenase [NAD(P)+] activity
GO:0004029	0.990	aldehyde dehydrogenase (NAD+) activity
GO:0005488	0.972	binding
GO:0005515	0.792	protein binding
GO:0042802	0.416	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044237	0.993	cellular metabolic process
GO:0044238	0.992	primary metabolic process
GO:0006720	0.944	isoprenoid metabolic process
GO:0001523	0.929	retinoid metabolic process
GO:0050896	0.764	response to stimulus
GO:0065007	0.754	biological regulation
GO:0051716	0.580	cellular response to stimulus
GO:0032501	0.496	multicellular organismal process
GO:0044281	0.441	small molecule metabolic process
GO:0042221	0.419	response to chemical
GO:0070887	0.394	cellular response to chemical stimulus
GO:0050794	0.379	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005829	0.958	cytosol
GO:0043227	0.951	membrane-bounded organelle
GO:0043231	0.834	intracellular membrane-bounded organelle
GO:0070062	0.523	extracellular exosome
GO:0005634	0.388	nucleus
GO:0016020	0.315	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.2.1.5	1.000	aldehyde dehydrogenase [NAD(P)(+)].
RHEA:16185	0.990	an aldehyde + H2O + NAD(+) = a carboxylate + 2 H(+) + NADH
EC:1.2.1.3	0.990	aldehyde dehydrogenase (NAD(+)).

[back to server]