StarFunc result for job id P00367

User Input

>input (558 residues)
MYRYLGEALLLSRAGPAALGSASADSAALLGWARGQPAAAPQPGLALAARRHYSEAVADR
EDDPNFFKMVEGFFDRGASIVEDKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSLSF
PIRRDDGSWEVIEGYRAQHSQHRTPCKGGIRYSTDVSVDEVKALASLMTYKCAVVDVPFG
GAKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGEREMSWIADTY
ASTIGHYDINAHACVTGKPISQGGIHGRISATGRGVFHGIENFINEASYMSILGMTPGFG
DKTFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILG
FPKAKPYEGSILEADCDILIPAASEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLER
NIMVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLMSVQESLERKFGK
HGGTIPIVPTAEFQDRISGASEKDIVHSGLAYTMERSARQIMRTAMKYNLGLDLRTAAYV
NAIEKVFKVYNEAGVTFT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A140VK14	0.925	0.925	9.488E-94	558	0.955	0.955	A0A140VK14.pdb.gz	A0A140VK14_HUMAN glutamate dehydrogenase [NAD(P)(+)] OS=Homo sapiens OX=9606 PE=2 SV=1
2	AFDB:Q8JHY1	0.893	0.916	2.690E-86	544	0.835	0.857	Q8JHY1.pdb.gz	Q8JHY1_ONCMY glutamate dehydrogenase [NAD(P)(+)] OS=Oncorhynchus mykiss OX=8022 GN=GDH01 PE=2 SV=1
3	AFDB:Q8JG17	0.893	0.925	1.472E-84	539	0.806	0.835	Q8JG17.pdb.gz	Q8JG17_ONCMY glutamate dehydrogenase [NAD(P)(+)] (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=gdh1 PE=2 SV=1
4	PDB:6dhdA	0.893	0.994	1.438E-83	501	0.880	0.980	6dhdA.pdb.gz	Structures of bovine glutamate dehydrogenase complexes elucidate the mechanism of purine regulation.
5	AFDB:P54385	0.837	0.832	2.386E-70	562	0.651	0.646	P54385.pdb.gz	DHE3_DROME Glutamate dehydrogenase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Gdh PE=1 SV=2
6	AFDB:Q9VCN3	0.835	0.869	2.016E-55	535	0.421	0.439	Q9VCN3.pdb.gz	Q9VCN3_DROME Glutamate dehydrogenase OS=Drosophila melanogaster OX=7227 GN=bb8 PE=1 SV=2
7	AFDB:Q54KB7	0.796	0.883	1.568E-54	502	0.450	0.500	Q54KB7.pdb.gz	DHE3_DICDI Glutamate dehydrogenase, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=gluD PE=1 SV=1
8	AFDB:Q38946	0.694	0.935	1.704E-40	411	0.294	0.399	Q38946.pdb.gz	DHE2_ARATH Glutamate dehydrogenase 2 OS=Arabidopsis thaliana OX=3702 GN=GDH2 PE=1 SV=1
9	AFDB:Q43314	0.701	0.945	2.081E-40	411	0.299	0.406	Q43314.pdb.gz	DHE1_ARATH Glutamate dehydrogenase 1 OS=Arabidopsis thaliana OX=3702 GN=GDH1 PE=1 SV=1
10	PDB:5k12A	0.511	0.958	1.583E-39	294	0.523	0.993	5k12A.pdb.gz
11	AFDB:Q852M0	0.698	0.942	2.669E-39	411	0.278	0.377	Q852M0.pdb.gz	DHE1_ORYSJ Glutamate dehydrogenase 1, mitochondrial OS=Oryza sativa subsp. japonica OX=39947 GN=GDH1 PE=2 SV=1
12	AFDB:Q6H3Y7	0.695	0.937	5.115E-39	411	0.287	0.389	Q6H3Y7.pdb.gz	DHE3_ORYSJ Glutamate dehydrogenase 3, mitochondrial OS=Oryza sativa subsp. japonica OX=39947 GN=GDH3 PE=2 SV=1
13	PDB:6yehA	0.667	0.895	8.651E-37	410	0.296	0.402	6yehA.pdb.gz	Structural Studies of Glutamate Dehydrogenase (Isoform 1) FromArabidopsis thaliana, an Important Enzyme at the Branch-Point Between Carbon and Nitrogen Metabolism.
14	PDB:3k92A	0.671	0.882	1.919E-33	418	0.263	0.352	3k92A.pdb.gz
15	PDB:7mftA	0.609	0.804	2.464E-33	410	0.272	0.371	7mftA.pdb.gz	A counter-enzyme complex regulates glutamate metabolism in Bacillus subtilis.
16	PDB:3k8zA	0.563	0.797	6.368E-32	378	0.260	0.384	3k8zA.pdb.gz
17	PDB:2yfqB	0.603	0.820	7.038E-32	397	0.249	0.350	2yfqB.pdb.gz
18	PDB:7f79C	0.682	0.823	1.100E-28	458	0.210	0.255	7f79C.pdb.gz	Crystal structure of glutamate dehydrogenase 3 from Candida albicans.
19	PDB:3r3jA	0.645	0.775	2.108E-28	456	0.222	0.272	3r3jA.pdb.gz
20	PDB:3sboC	0.673	0.836	2.327E-27	442	0.201	0.253	3sboC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A140VK14	0.0	1110	558	0.957	0.957	A0A140VK14_HUMAN glutamate dehydrogenase [NAD(P)(+)] OS=Homo sapiens OX=9606 PE=2 SV=1
2	E9KL48	0.0	1157	558	1.000	1.000	E9KL48_HUMAN glutamate dehydrogenase [NAD(P)(+)] OS=Homo sapiens OX=9606 GN=GLUD1 PE=2 SV=1
3	P00366	0.0	1133	558	0.975	0.975	DHE3_BOVIN Glutamate dehydrogenase 1, mitochondrial OS=Bos taurus OX=9913 GN=GLUD1 PE=1 SV=2
4	P00367	0.0	1157	558	1.000	1.000	DHE3_HUMAN Glutamate dehydrogenase 1, mitochondrial OS=Homo sapiens OX=9606 GN=GLUD1 PE=1 SV=2
5	P10860	0.0	1128	558	0.970	0.970	DHE3_RAT Glutamate dehydrogenase 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Glud1 PE=1 SV=2
6	P26443	0.0	1137	558	0.978	0.978	DHE3_MOUSE Glutamate dehydrogenase 1, mitochondrial OS=Mus musculus OX=10090 GN=Glud1 PE=1 SV=1
7	P49448	0.0	1110	558	0.957	0.957	DHE4_HUMAN Glutamate dehydrogenase 2, mitochondrial OS=Homo sapiens OX=9606 GN=GLUD2 PE=1 SV=2
8	P54385	0.0	777	562	0.656	0.651	DHE3_DROME Glutamate dehydrogenase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Gdh PE=1 SV=2
9	Q70PJ6	0.0	854	442	0.715	0.903	Q70PJ6_ONCMY glutamate dehydrogenase [NAD(P)(+)] (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=gdh3.2 PE=2 SV=1
10	Q70PJ7	0.0	850	440	0.713	0.905	Q70PJ7_ONCMY glutamate dehydrogenase [NAD(P)(+)] (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=gdh3.1 PE=2 SV=1
11	Q8JG17	0.0	940	539	0.812	0.840	Q8JG17_ONCMY glutamate dehydrogenase [NAD(P)(+)] (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=gdh1 PE=2 SV=1
12	Q8JHX9	0.0	952	539	0.819	0.848	Q8JHX9_ONCMY Glutamate dehydrogenase OS=Oncorhynchus mykiss OX=8022 GN=GDH03 PE=2 SV=1
13	Q8JHY1	0.0	980	544	0.839	0.860	Q8JHY1_ONCMY glutamate dehydrogenase [NAD(P)(+)] OS=Oncorhynchus mykiss OX=8022 GN=GDH01 PE=2 SV=1
14	Q54KB7	1.07e-164	479	502	0.453	0.504	DHE3_DICDI Glutamate dehydrogenase, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=gluD PE=1 SV=1
15	Q9VCN3	8.36e-159	466	535	0.416	0.434	Q9VCN3_DROME Glutamate dehydrogenase OS=Drosophila melanogaster OX=7227 GN=bb8 PE=1 SV=2
16	Q8JHY0	5.58e-144	416	214	0.348	0.907	Q8JHY0_ONCMY Glutamate dehydrogenase 2 (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=GDH02 PE=2 SV=1
17	Q8JG16	3.37e-121	357	217	0.321	0.825	Q8JG16_ONCMY Glutamate dehydrogenase (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=gdh2 PE=2 SV=1
18	Q70PJ5	1.70e-86	265	138	0.224	0.906	Q70PJ5_ONCMY Glutamate dehydrogenase (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=gdh1.2 PE=2 SV=1
19	Q43314	2.96e-86	275	411	0.269	0.365	DHE1_ARATH Glutamate dehydrogenase 1 OS=Arabidopsis thaliana OX=3702 GN=GDH1 PE=1 SV=1
20	Q33E23	1.80e-85	273	411	0.269	0.365	DHE2_ORYSJ Glutamate dehydrogenase 2, mitochondrial OS=Oryza sativa subsp. japonica OX=39947 GN=GDH2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02826 2-Hacid_dh_C	2.1e+02	12.6	D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
2	PF00208 ELFV_dehydrog	6.8e-50	181.6	Glutamate/Leucine/Phenylalanine/Valine dehydrogenase
3	PF02812 ELFV_dehydrog_N	1.2e-54	195.0	Glu/Leu/Phe/Val dehydrogenase, dimerisation domain
4	PF07189 SF3b10	2.8e+02	13.0	Splicing factor 3B subunit 10 (SF3b10)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000277865

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000307900	0.985	Glutamine synthetase
2	9606.ENSP00000245206	0.978	Aspartate aminotransferase, mitochondrial
3	9606.ENSP00000359539	0.973	Aspartate aminotransferase, cytoplasmic
4	9606.ENSP00000317379	0.970	Glutaminase kidney isoform, mitochondrial
5	9606.ENSP00000345282	0.970	Alanine aminotransferase 2
6	9606.ENSP00000310447	0.969	Glutaminase liver isoform, mitochondrial
7	9606.ENSP00000360268	0.966	Delta-1-pyrroline-5-carboxylate synthase
8	9606.ENSP00000202967	0.965	NAD-dependent protein lipoamidase sirtuin-4, mitochondrial
9	9606.ENSP00000364490	0.965	Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial
10	9606.ENSP00000293404	0.956	N-acetylglutamate synthase, mitochondrial
11	9606.ENSP00000327070	0.954	Malate dehydrogenase, mitochondrial
12	9606.ENSP00000372191	0.954	NAD-dependent protein deacetylase sirtuin-3, mitochondrial
13	9606.ENSP00000378408	0.954	Alanine aminotransferase 1
14	9606.ENSP00000402608	0.953	Carbamoyl-phosphate synthase [ammonia], mitochondrial
15	9606.ENSP00000327589	0.948	Glutamate dehydrogenase 2, mitochondrial
16	9606.ENSP00000303077	0.935	Putative aspartate aminotransferase, cytoplasmic 2
17	9606.ENSP00000350928	0.935	Glutamate decarboxylase 1
18	9606.ENSP00000363216	0.934	2-oxoglutarate dehydrogenase-like, mitochondrial
19	9606.ENSP00000222673	0.933	2-oxoglutarate dehydrogenase, mitochondrial
20	9606.ENSP00000342056	0.933	Citrate synthase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004353	1.000	glutamate dehydrogenase [NAD(P)+] activity
GO:0005515	0.998	protein binding
GO:0042802	0.970	identical protein binding
GO:0097159	0.773	organic cyclic compound binding
GO:1901363	0.763	heterocyclic compound binding
GO:0043167	0.711	ion binding
GO:0004352	0.696	glutamate dehydrogenase (NAD+) activity
GO:0036094	0.564	small molecule binding
GO:0017076	0.396	purine nucleotide binding
GO:0043168	0.389	anion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.996	primary metabolic process
GO:0044237	0.996	cellular metabolic process
GO:1901564	0.995	organonitrogen compound metabolic process
GO:0009064	0.992	glutamine family amino acid metabolic process
GO:0043648	0.897	dicarboxylic acid metabolic process
GO:0009063	0.890	amino acid catabolic process
GO:1901606	0.882	alpha-amino acid catabolic process
GO:0043603	0.863	amide metabolic process
GO:0009065	0.844	glutamine family amino acid catabolic process
GO:0006536	0.703	glutamate metabolic process
GO:0009058	0.439	biosynthetic process
GO:0065007	0.410	biological regulation
GO:1901576	0.389	organic substance biosynthetic process
GO:0050789	0.363	regulation of biological process
GO:0034641	0.362	cellular nitrogen compound metabolic process
GO:0044249	0.308	cellular biosynthetic process
GO:0050794	0.301	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.961	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.4.1.3	1.000	glutamate dehydrogenase [NAD(P)(+)].
RHEA:15133	0.696	H2O + L-glutamate + NAD(+) = 2-oxoglutarate + H(+) + NADH + NH4(+)
EC:1.4.1.2	0.696	glutamate dehydrogenase.

[back to server]