StarFunc result for job id P00387

User Input

>input (301 residues)
MGAQLSTLGHMVLFPVWFLYSLLMKLFQRSTPAITLESPDIKYPLRLIDREIISHDTRRF
RFALPSPQHILGLPVGQHIYLSARIDGNLVVRPYTPISSDDDKGFVDLVIKVYFKDTHPK
FPAGGKMSQYLESMQIGDTIEFRGPSGLLVYQGKGKFAIRPDKKSNPIIRTVKSVGMIAG
GTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLD
RAPEAWDYGQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLDHVGHPTERCFV
F

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P00387	1.000	1.000	4.672E-68	301	1.000	1.000	P00387.pdb.gz	NB5R3_HUMAN NADH-cytochrome b5 reductase 3 OS=Homo sapiens OX=9606 GN=CYB5R3 PE=1 SV=3
2	AFDB:P20070	0.968	0.968	1.893E-61	301	0.870	0.870	P20070.pdb.gz	NB5R3_RAT NADH-cytochrome b5 reductase 3 OS=Rattus norvegicus OX=10116 GN=Cyb5r3 PE=1 SV=2
3	PDB:5gv7A	0.900	0.995	1.109E-58	272	0.837	0.926	5gv7A.pdb.gz	Distribution of valence electrons of the flavin cofactor in NADH-cytochrome b5 reductase.
4	AFDB:Q1MTC9	0.916	0.926	2.208E-56	298	0.711	0.718	Q1MTC9.pdb.gz
5	AFDB:B5X1Q9	0.963	0.969	3.450E-54	299	0.678	0.682	B5X1Q9.pdb.gz	B5X1Q9_SALSA NADH-cytochrome b5 reductase OS=Salmo salar OX=8030 GN=NB5R3 PE=2 SV=1
6	AFDB:Q9DB73	0.960	0.947	6.079E-52	305	0.618	0.610	Q9DB73.pdb.gz	NB5R1_MOUSE NADH-cytochrome b5 reductase 1 OS=Mus musculus OX=10090 GN=Cyb5r1 PE=1 SV=1
7	AFDB:Q0P487	0.897	0.874	9.499E-50	309	0.605	0.589	Q0P487.pdb.gz	NB5R2_DANRE NADH-cytochrome b5 reductase 2 OS=Danio rerio OX=7955 GN=cyb5r2 PE=2 SV=2
8	AFDB:Q6BCY4	0.901	0.982	1.118E-48	276	0.542	0.591	Q6BCY4.pdb.gz	NB5R2_HUMAN NADH-cytochrome b5 reductase 2 OS=Homo sapiens OX=9606 GN=CYB5R2 PE=1 SV=1
9	AFDB:Q9I7R1	0.890	0.856	3.505E-48	313	0.561	0.540	Q9I7R1.pdb.gz	Q9I7R1_DROME NADH-cytochrome b5 reductase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG5946 PE=1 SV=2
10	AFDB:Q3KNK3	0.902	0.983	2.876E-47	276	0.532	0.580	Q3KNK3.pdb.gz	NB5R2_MOUSE NADH-cytochrome b5 reductase 2 OS=Mus musculus OX=10090 GN=Cyb5r2 PE=2 SV=2
11	AFDB:X2JGK6	0.884	0.807	2.360E-46	330	0.561	0.512	X2JGK6.pdb.gz	X2JGK6_DROME NADH-cytochrome b5 reductase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG5946 PE=1 SV=1
12	PDB:7romA	0.734	0.861	1.465E-29	255	0.312	0.369	7romA.pdb.gz	Crystal structure of Saccharomyces cerevisiae NADH-cytochrome b5 reductase 1 (Cbr1) fragment (residues 28-284) bound to FAD
13	PDB:7xk3F	0.674	0.509	3.192E-15	408	0.173	0.127	7xk3F.pdb.gz	Cryo-EM structures of Na + -pumping NADH-ubiquinone oxidoreductase from Vibrio cholerae.
14	PDB:1fdrA	0.614	0.743	3.757E-14	244	0.176	0.217	1fdrA.pdb.gz	The three-dimensional structure of flavodoxin reductase from Escherichia coli at 1.7 A resolution.
15	PDB:1gvhA	0.671	0.521	3.990E-14	396	0.163	0.124	1gvhA.pdb.gz	The X-Ray Structure of Ferric Escherichia Coli Flavohemoglobin Reveals an Unexpected Geometry of the Distal Heme Pocket
16	PDB:3crzA	0.584	0.672	4.237E-14	257	0.159	0.187	3crzA.pdb.gz	X-ray crystallographic and solution state nuclear magnetic resonance spectroscopic investigations of NADP+ binding to ferredoxin NADP reductase from Pseudomonas aeruginosa
17	PDB:1cqxA	0.558	0.437	1.328E-13	403	0.183	0.136	1cqxA.pdb.gz	Crystal structure of the flavohemoglobin from Alcaligenes eutrophus at 1.75 A resolution.
18	PDB:1qfjA	0.630	0.819	3.083E-13	226	0.153	0.204	1qfjA.pdb.gz
19	PDB:3lvbA	0.636	0.618	7.467E-12	311	0.169	0.164	3lvbA.pdb.gz	Biochemical and crystallographic characterization of ferredoxin-NADP(+) reductase from nonphotosynthetic tissues
20	PDB:1ep1B	0.570	0.648	1.071E-11	261	0.130	0.149	1ep1B.pdb.gz	Structure of dihydroorotate dehydrogenase B: electron transfer between two flavin groups bridged by an iron-sulphur cluster.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P00387	0.0	621	301	1.000	1.000	NB5R3_HUMAN NADH-cytochrome b5 reductase 3 OS=Homo sapiens OX=9606 GN=CYB5R3 PE=1 SV=3
2	P07514	0.0	593	301	0.930	0.930	NB5R3_BOVIN NADH-cytochrome b5 reductase 3 OS=Bos taurus OX=9913 GN=CYB5R3 PE=1 SV=3
3	P20070	0.0	566	301	0.870	0.870	NB5R3_RAT NADH-cytochrome b5 reductase 3 OS=Rattus norvegicus OX=10116 GN=Cyb5r3 PE=1 SV=2
4	P83686	0.0	537	272	0.837	0.926	NB5R3_PIG NADH-cytochrome b5 reductase 3 (Fragment) OS=Sus scrofa OX=9823 GN=CYB5R3 PE=1 SV=1
5	Q0X0E5	0.0	587	301	0.927	0.927	NB5R3_CANLF NADH-cytochrome b5 reductase 3 OS=Canis lupus familiaris OX=9615 GN=CYB5R3 PE=1 SV=1
6	Q9DCN2	0.0	567	301	0.874	0.874	NB5R3_MOUSE NADH-cytochrome b5 reductase 3 OS=Mus musculus OX=10090 GN=Cyb5r3 PE=1 SV=3
7	Q6NYE6	1.13e-165	463	298	0.714	0.721	Q6NYE6_DANRE NADH-cytochrome b5 reductase OS=Danio rerio OX=7955 GN=fc32h03 PE=1 SV=1
8	B5X1Q9	1.94e-155	437	299	0.671	0.676	B5X1Q9_SALSA NADH-cytochrome b5 reductase OS=Salmo salar OX=8030 GN=NB5R3 PE=2 SV=1
9	B5XEF8	4.68e-150	424	294	0.664	0.680	B5XEF8_SALSA NADH-cytochrome b5 reductase OS=Salmo salar OX=8030 GN=NB5R3 PE=2 SV=1
10	Q0P487	9.33e-135	385	309	0.578	0.563	NB5R2_DANRE NADH-cytochrome b5 reductase 2 OS=Danio rerio OX=7955 GN=cyb5r2 PE=2 SV=2
11	Q9DB73	1.39e-134	385	305	0.595	0.587	NB5R1_MOUSE NADH-cytochrome b5 reductase 1 OS=Mus musculus OX=10090 GN=Cyb5r1 PE=1 SV=1
12	Q9UHQ9	5.83e-131	376	305	0.585	0.577	NB5R1_HUMAN NADH-cytochrome b5 reductase 1 OS=Homo sapiens OX=9606 GN=CYB5R1 PE=1 SV=1
13	Q6BCY4	8.55e-121	349	276	0.542	0.591	NB5R2_HUMAN NADH-cytochrome b5 reductase 2 OS=Homo sapiens OX=9606 GN=CYB5R2 PE=1 SV=1
14	Q3KNK3	5.67e-120	347	276	0.532	0.580	NB5R2_MOUSE NADH-cytochrome b5 reductase 2 OS=Mus musculus OX=10090 GN=Cyb5r2 PE=2 SV=2
15	Q0E8F4	3.68e-119	346	313	0.548	0.527	Q0E8F4_DROME NADH-cytochrome b5 reductase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG5946 PE=1 SV=1
16	Q0E8F5	4.03e-119	346	316	0.548	0.522	Q0E8F5_DROME NADH-cytochrome b5 reductase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG5946 PE=1 SV=1
17	Q4LDP7	7.61e-118	343	316	0.555	0.528	Q4LDP7_DROME NADH-cytochrome b5 reductase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG5946 PE=1 SV=1
18	Q9I7R1	1.12e-117	342	313	0.555	0.534	Q9I7R1_DROME NADH-cytochrome b5 reductase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG5946 PE=1 SV=2
19	X2JGK6	3.26e-115	337	330	0.548	0.500	X2JGK6_DROME NADH-cytochrome b5 reductase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG5946 PE=1 SV=1
20	E1JHY0	2.41e-93	279	263	0.455	0.521	E1JHY0_DROME NADH-cytochrome b5 reductase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG5946 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00970 FAD_binding_6	1.6e-33	126.3	Oxidoreductase FAD-binding domain
2	PF08021 FAD_binding_9	1.7e+02	13.9	Siderophore-interacting FAD-binding domain
3	PF00175 NAD_binding_1	3.7e-33	125.8	Oxidoreductase NAD-binding domain
4	PF08030 NAD_binding_6	0.092	24.3	Ferric reductase NAD binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354468

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000341625	0.996	Cytochrome b5
2	9606.ENSP00000308430	0.936	Cytochrome b5 type B
3	9606.ENSP00000322421	0.904	Hemoglobin subunit alpha
4	9606.ENSP00000251595	0.873	Hemoglobin subunit alpha 2
5	9606.ENSP00000333994	0.821	Hemoglobin subunit beta
6	9606.ENSP00000355877	0.792	Mitochondrial amidoxime-reducing component 1
7	9606.ENSP00000355880	0.780	Mitochondrial amidoxime reducing component 2
8	9606.ENSP00000383178	0.769	Protein diaphanous homolog 3
9	9606.ENSP00000419970	0.768	NADPH--cytochrome P450 reductase
10	9606.ENSP00000307199	0.764	Alpha-hemoglobin-stabilizing protein
11	9606.ENSP00000216124	0.741	Arylsulfatase A
12	9606.ENSP00000003100	0.734	Lanosterol 14-alpha demethylase
13	9606.ENSP00000369609	0.639	Hemoglobin subunit gamma-2
14	9606.ENSP00000307786	0.577	Cytochrome c
15	9606.ENSP00000252951	0.570	Hemoglobin subunit zeta
16	9606.ENSP00000199708	0.560	Hemoglobin subunit theta 1
17	9606.ENSP00000327431	0.560	Hemoglobin subunit gamma 1
18	9606.ENSP00000349270	0.560	Hemoglobin subunit mu
19	9606.ENSP00000369586	0.560	Hemoglobin subunit epsilon
20	9606.ENSP00000369654	0.560	Hemoglobin subunit delta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016653	0.999	oxidoreductase activity, acting on NAD(P)H, heme protein as acceptor
GO:0071949	0.999	FAD binding
GO:0005515	0.990	protein binding
GO:0004128	0.899	cytochrome-b5 reductase activity, acting on NAD(P)H
GO:0098809	0.342	nitrite reductase activity
GO:0016662	0.332	oxidoreductase activity, acting on other nitrogenous compounds as donors, cytochrome as acceptor

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.994	cellular metabolic process
GO:0006807	0.878	nitrogen compound metabolic process
GO:2001057	0.784	reactive nitrogen species metabolic process
GO:0009058	0.778	biosynthetic process
GO:0034641	0.754	cellular nitrogen compound metabolic process
GO:0044249	0.739	cellular biosynthetic process
GO:0032501	0.733	multicellular organismal process
GO:0071704	0.728	organic substance metabolic process
GO:0006809	0.691	nitric oxide biosynthetic process
GO:0003013	0.422	circulatory system process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031090	0.998	organelle membrane
GO:0005739	0.996	mitochondrion
GO:0012505	0.992	endomembrane system
GO:0031967	0.936	organelle envelope
GO:0031966	0.919	mitochondrial membrane
GO:0005783	0.791	endoplasmic reticulum
GO:0042175	0.601	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0031984	0.578	organelle subcompartment
GO:0005829	0.548	cytosol
GO:0005789	0.523	endoplasmic reticulum membrane
GO:0070013	0.440	intracellular organelle lumen
GO:0098588	0.391	bounding membrane of organelle
GO:0005576	0.359	extracellular region
GO:0019867	0.335	outer membrane
GO:0070062	0.335	extracellular exosome
GO:0031968	0.324	organelle outer membrane
GO:0005741	0.300	mitochondrial outer membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.6.2.-	0.999	With a heme protein as acceptor.
RHEA:46680	0.899	2 Fe(III)-[cytochrome b5] + NADH = 2 Fe(II)-[cytochrome b5] + H(+) + NAD(+)
EC:1.6.2.2	0.899	cytochrome-b5 reductase.
EC:1.7.-.-	0.342	Acting on other nitrogenous compounds as donors.
EC:1.7.2.-	0.332	With a cytochrome as acceptor.

[back to server]