StarFunc result for job id P00390

User Input

>input (522 residues)
MALLPRALSAGAGPSWRRAARAFRGFLLLLPEPAALTRALSRAMACRQEPQPQGPPPAAG
AVASYDYLVIGGGSGGLASARRAAELGARAAVVESHKLGGTCVNVGCVPKKVMWNTAVHS
EFMHDHADYGFPSCEGKFNWRVIKEKRDAYVSRLNAIYQNNLTKSHIEIIRGHAAFTSDP
KPTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELPGRSVIVGAG
YIAVEMAGILSALGSKTSLMIRHDKVLRSFDSMISTNCTEELENAGVEVLKFSQVKEVKK
TLSGLEVSMVTAVPGRLPVMTMIPDVDCLLWAIGRVPNTKDLSLNKLGIQTDDKGHIIVD
EFQNTNVKGIYAVGDVCGKALLTPVAIAAGRKLAHRLFEYKEDSKLDYNNIPTVVFSHPP
IGTVGLTEDEAIHKYGIENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQ
GLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P00390	1.000	1.000	0.000	522	1.000	1.000	P00390.pdb.gz	GSHR_HUMAN Glutathione reductase, mitochondrial OS=Homo sapiens OX=9606 GN=GSR PE=1 SV=2
2	PDB:3djjA	0.884	0.999	9.303E-97	462	0.885	1.000	3djjA.pdb.gz	Catalytic cycle of human glutathione reductase near 1 A resolution.
3	AFDB:P47791	0.885	0.923	1.509E-95	500	0.830	0.866	P47791.pdb.gz	GSHR_MOUSE Glutathione reductase, mitochondrial OS=Mus musculus OX=10090 GN=Gsr PE=1 SV=3
4	AFDB:Q93379	0.853	0.941	5.161E-69	473	0.517	0.571	Q93379.pdb.gz	GSHR_CAEEL Glutathione reductase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=gsr-1 PE=1 SV=2
5	AFDB:Q8T137	0.831	0.931	7.555E-67	465	0.487	0.546	Q8T137.pdb.gz	GSHR_DICDI Glutathione reductase OS=Dictyostelium discoideum OX=44689 GN=gsr PE=1 SV=2
6	AFDB:P06715	0.833	0.964	1.488E-65	450	0.479	0.556	P06715.pdb.gz	GSHR_ECOLI Glutathione reductase OS=Escherichia coli (strain K12) OX=83333 GN=gor PE=1 SV=1
7	PDB:1gerB	0.830	0.961	1.521E-65	449	0.477	0.555	1gerB.pdb.gz	Structure of glutathione reductase from Escherichia coli at 1.86 A resolution: comparison with the enzyme from human erythrocytes.
8	AFDB:P41921	0.834	0.901	3.942E-65	483	0.452	0.489	P41921.pdb.gz	GSHR_YEAST Glutathione reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GLR1 PE=1 SV=2
9	PDB:2hqmA	0.832	0.941	1.198E-64	461	0.450	0.510	2hqmA.pdb.gz	Crystal structure of glutathione reductase Glr1 from the yeast Saccharomyces cerevisiae.
10	AFDB:Q6FRV2	0.842	0.921	1.560E-64	476	0.444	0.487	Q6FRV2.pdb.gz	GSHR_CANGA Glutathione reductase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=GLR1 PE=3 SV=1
11	AFDB:Q59NQ5	0.822	0.832	6.472E-63	516	0.460	0.465	Q59NQ5.pdb.gz	Q59NQ5_CANAL Glutathione reductase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GLR1 PE=3 SV=1
12	AFDB:P78965	0.829	0.930	1.715E-62	464	0.450	0.506	P78965.pdb.gz	GSHR_SCHPO Glutathione reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pgr1 PE=1 SV=2
13	AFDB:C8VUN9	0.837	0.785	3.042E-62	557	0.483	0.452	C8VUN9.pdb.gz	C8VUN9_EMENI Glutathione reductase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00932 PE=3 SV=1
14	PDB:6btlA	0.796	0.843	3.210E-48	492	0.335	0.356	6btlA.pdb.gz	Biological Evaluation and X-ray Co-crystal Structures of Cyclohexylpyrrolidine Ligands for Trypanothione Reductase, an Enzyme from the Redox Metabolism of Trypanosoma.
15	PDB:1zdlA	0.830	0.894	7.162E-48	484	0.368	0.397	1zdlA.pdb.gz	Crystal structures of oxidized and reduced mitochondrial thioredoxin reductase provide molecular details of the reaction mechanism.
16	PDB:3eanD	0.823	0.873	4.233E-47	491	0.318	0.338	3eanD.pdb.gz	Crystal structure and catalysis of the selenoprotein thioredoxin reductase 1.
17	PDB:1ebdA	0.792	0.904	5.362E-42	455	0.247	0.284	1ebdA.pdb.gz	Protein-protein interactions in the pyruvate dehydrogenase multienzyme complex: dihydrolipoamide dehydrogenase complexed with the binding domain of dihydrolipoamide acetyltransferase.
18	PDB:7kmyA	0.788	0.880	7.563E-42	465	0.241	0.271	7kmyA.pdb.gz	Whole cell active inhibitors of mycobacterial lipoamide dehydrogenase afford selectivity over the human enzyme through tight binding interactions
19	PDB:1jehA	0.790	0.860	2.993E-41	478	0.245	0.268	1jehA.pdb.gz	Crystal structure of eucaryotic E3, lipoamide dehydrogenase from yeast.
20	PDB:6hg8B	0.793	0.856	4.734E-41	482	0.247	0.268	6hg8B.pdb.gz	Crystal structure of the R460G disease-causing mutant of the human dihydrolipoamide dehydrogenase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P00390	0.0	1082	522	1.000	1.000	GSHR_HUMAN Glutathione reductase, mitochondrial OS=Homo sapiens OX=9606 GN=GSR PE=1 SV=2
2	P47791	0.0	877	500	0.830	0.866	GSHR_MOUSE Glutathione reductase, mitochondrial OS=Mus musculus OX=10090 GN=Gsr PE=1 SV=3
3	P70619	0.0	765	424	0.701	0.863	GSHR_RAT Glutathione reductase (Fragment) OS=Rattus norvegicus OX=10116 GN=Gsr PE=2 SV=2
4	V9HW90	0.0	1082	522	1.000	1.000	V9HW90_HUMAN Glutathione reductase OS=Homo sapiens OX=9606 GN=HEL-75 PE=2 SV=1
5	Q8T137	4.22e-176	506	465	0.494	0.555	GSHR_DICDI Glutathione reductase OS=Dictyostelium discoideum OX=44689 GN=gsr PE=1 SV=2
6	Q93379	7.19e-171	493	473	0.519	0.573	GSHR_CAEEL Glutathione reductase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=gsr-1 PE=1 SV=2
7	P06715	2.23e-160	465	450	0.485	0.562	GSHR_ECOLI Glutathione reductase OS=Escherichia coli (strain K12) OX=83333 GN=gor PE=1 SV=1
8	P41921	3.35e-146	430	483	0.456	0.493	GSHR_YEAST Glutathione reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GLR1 PE=1 SV=2
9	P78965	1.12e-144	426	464	0.456	0.513	GSHR_SCHPO Glutathione reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pgr1 PE=1 SV=2
10	Q6FRV2	1.80e-144	426	476	0.450	0.494	GSHR_CANGA Glutathione reductase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=GLR1 PE=3 SV=1
11	Q59NQ5	5.20e-142	421	516	0.464	0.469	Q59NQ5_CANAL Glutathione reductase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GLR1 PE=3 SV=1
12	C8VUN9	2.13e-132	397	557	0.481	0.451	C8VUN9_EMENI Glutathione reductase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00932 PE=3 SV=1
13	Q2RWK9	2.01e-106	327	459	0.352	0.401	Q2RWK9_RHORT Glutathione reductase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1) OX=269796 GN=Rru_A0682 PE=3 SV=1
14	O15770	1.79e-105	328	546	0.391	0.374	GSHR_PLAF7 Glutathione reductase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=GR PE=1 SV=5
15	Q9JLT4	1.93e-102	319	524	0.393	0.391	TRXR2_MOUSE Thioredoxin reductase 2, mitochondrial OS=Mus musculus OX=10090 GN=Txnrd2 PE=1 SV=4
16	P42770	2.87e-99	312	565	0.360	0.333	GSHRP_ARATH Glutathione reductase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=EMB2360 PE=2 SV=1
17	Q9Z0J5	4.64e-97	305	526	0.362	0.359	TRXR2_RAT Thioredoxin reductase 2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Txnrd2 PE=1 SV=3
18	P30635	7.01e-96	301	503	0.349	0.362	TRXR2_CAEEL Probable glutathione reductase 2 OS=Caenorhabditis elegans OX=6239 GN=trxr-2 PE=3 SV=2
19	Q9N2I8	6.23e-95	299	511	0.366	0.374	TRXR2_BOVIN Thioredoxin reductase 2, mitochondrial OS=Bos taurus OX=9913 GN=TXNRD2 PE=1 SV=2
20	P48641	5.56e-94	296	499	0.343	0.359	GSHRC_ARATH Glutathione reductase, cytosolic OS=Arabidopsis thaliana OX=3702 GN=At3g24170 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02826 2-Hacid_dh_C	3.2e+02	12.1	D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
2	PF01262 AlaDh_PNT_C	0.025	25.4	Alanine dehydrogenase/PNT, C-terminal domain
3	PF01266 DAO	59	14.7	FAD dependent oxidoreductase
4	PF00890 FAD_binding_2	0.01	26.6	FAD binding domain
5	PF01494 FAD_binding_3	4.3e+02	11.5	FAD binding domain
6	PF12831 FAD_oxidored	0.0031	28.5	FAD dependent oxidoreductase
7	PF01134 GIDA	4.3	17.9	Glucose inhibited division protein A
8	PF03486 HI0933_like	31	14.7	HI0933-like protein
9	PF13450 NAD_binding_8	58	15.3	NAD(P)-binding Rossmann-like domain
10	PF00070 Pyr_redox	1.9e-18	78.0	Pyridine nucleotide-disulphide oxidoreductase
11	PF07992 Pyr_redox_2	3.3e-57	205.6	Pyridine nucleotide-disulphide oxidoreductase
12	PF13738 Pyr_redox_3	1.7e-13	62.1	Pyridine nucleotide-disulphide oxidoreductase
13	PF02852 Pyr_redox_dim	8.9e-33	124.2	Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000221130

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000374265	0.989	Glutathione peroxidase 2
2	9606.ENSP00000407375	0.989	Glutathione peroxidase 1
3	9606.ENSP00000346103	0.987	Phospholipid hydroperoxide glutathione peroxidase, mitochondrial
4	9606.ENSP00000354677	0.987	Glutathione peroxidase 7
5	9606.ENSP00000373477	0.987	Glutathione peroxidase 3
6	9606.ENSP00000216951	0.977	Glutathione synthetase
7	9606.ENSP00000241052	0.970	Catalase
8	9606.ENSP00000369314	0.969	Glutaredoxin-1
9	9606.ENSP00000363641	0.949	Thioredoxin
10	9606.ENSP00000383232	0.948	Glutathione hydrolase 1 proenzyme
11	9606.ENSP00000370962	0.935	Glutathione hydrolase 6
12	9606.ENSP00000295256	0.933	Hematopoietic prostaglandin D synthase
13	9606.ENSP00000338964	0.933	Glutathione hydrolase 7
14	9606.ENSP00000381340	0.932	Glutathione hydrolase 5 proenzyme
15	9606.ENSP00000229416	0.924	Glutamate-cysteine ligase catalytic subunit
16	9606.ENSP00000398105	0.917	Glutathione-specific gamma-glutamylcyclotransferase 1
17	9606.ENSP00000295304	0.911	Glutathione-specific gamma-glutamylcyclotransferase 2
18	9606.ENSP00000358851	0.901	Glutathione S-transferase Mu 4
19	9606.ENSP00000377192	0.892	Glucose-6-phosphate 1-dehydrogenase
20	9606.ENSP00000382428	0.885	Disks large homolog 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016209	1.000	antioxidant activity
GO:0015038	1.000	glutathione disulfide oxidoreductase activity
GO:0047134	1.000	protein-disulfide reductase (NAD(P)) activity
GO:0009055	0.996	electron transfer activity
GO:0005488	0.990	binding
GO:0004362	0.855	glutathione-disulfide reductase (NADPH) activity
GO:0043167	0.833	ion binding
GO:0005515	0.817	protein binding
GO:1901363	0.787	heterocyclic compound binding
GO:0097159	0.787	organic cyclic compound binding
GO:0036094	0.665	small molecule binding
GO:0043168	0.661	anion binding
GO:0000166	0.429	nucleotide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0006749	0.854	glutathione metabolic process
GO:0009987	0.840	cellular process
GO:0044237	0.765	cellular metabolic process
GO:0050896	0.694	response to stimulus
GO:0042221	0.516	response to chemical
GO:0044238	0.350	primary metabolic process
GO:0006807	0.322	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0005829	0.981	cytosol
GO:0005739	0.962	mitochondrion
GO:0070013	0.735	intracellular organelle lumen
GO:0070062	0.390	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.8.1.8	1.000	protein-disulfide reductase.
RHEA:11740	0.855	2 glutathione + NADP(+) = glutathione disulfide + H(+) + NADPH
EC:1.8.1.7	0.855	glutathione-disulfide reductase.

[back to server]