StarFunc result for job id P00414

User Input

>input (261 residues)
MTHQSHAYHMVKPSPWPLTGALSALLMTSGLAMWFHFHSMTLLMLGLLTNTLTMYQWWRD
VTRESTYQGHHTPPVQKGLRYGMILFITSEVFFFAGFFWAFYHSSLAPTPQLGGHWPPTG
ITPLNPLEVPLLNTSVLLASGVSITWAHHSLMENNRNQMIQALLITILLGLYFTLLQASE
YFESPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTICFIRQLMFHFTSKHHFGFEAAAW
YWHFVDVVWLFLYVSIYWWGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P00414	1.000	1.000	4.745E-35	261	1.000	1.000	P00414.pdb.gz	COX3_HUMAN Cytochrome c oxidase subunit 3 OS=Homo sapiens OX=9606 GN=MT-CO3 PE=1 SV=2
2	AFDB:P00415	0.991	0.991	1.259E-32	261	0.877	0.877	P00415.pdb.gz	COX3_BOVIN Cytochrome c oxidase subunit 3 OS=Bos taurus OX=9913 GN=MT-CO3 PE=1 SV=2
3	AFDB:P00416	1.000	1.000	2.706E-32	261	0.870	0.870	P00416.pdb.gz	COX3_MOUSE Cytochrome c oxidase subunit 3 OS=Mus musculus OX=10090 GN=mt-Co3 PE=1 SV=2
4	PDB:1occC	0.998	0.998	5.544E-32	261	0.874	0.874	1occC.pdb.gz	The whole structure of the 13-subunit oxidized cytochrome c oxidase at 2.8 A.
5	PDB:5z62C	0.987	0.990	6.022E-31	260	0.996	1.000	5z62C.pdb.gz	Structure of the intact 14-subunit human cytochrome c oxidase.
6	AFDB:P18945	0.999	0.999	9.055E-31	261	0.751	0.751	P18945.pdb.gz	COX3_CHICK Cytochrome c oxidase subunit 3 OS=Gallus gallus OX=9031 GN=MT-CO3 PE=3 SV=1
7	PDB:7o37c	0.987	0.994	7.434E-29	259	0.862	0.869	7o37c.pdb.gz	Structure and assembly of the mammalian mitochondrial supercomplex CIII 2 CIV.
8	AFDB:Q2F8Y5	0.968	0.903	6.327E-25	280	0.586	0.546	Q2F8Y5.pdb.gz	Q2F8Y5_ORYSJ Cytochrome c oxidase subunit 3 OS=Oryza sativa subsp. japonica OX=39947 GN=cox3 PE=3 SV=1
9	AFDB:P14575	0.980	0.951	2.499E-21	269	0.475	0.461	P14575.pdb.gz	COX3_SCHPO Cytochrome c oxidase subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cox3 PE=1 SV=4
10	AFDB:P00420	0.975	0.946	2.992E-21	269	0.437	0.424	P00420.pdb.gz	COX3_YEAST Cytochrome c oxidase subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COX3 PE=1 SV=3
11	PDB:6hu9c	0.976	0.948	3.415E-21	269	0.437	0.424	6hu9c.pdb.gz	Structure of yeast cytochrome c oxidase in a supercomplex with cytochrome bc1.
12	PDB:6wtiC	0.584	0.807	2.446E-6	186	0.176	0.247	6wtiC.pdb.gz	A 'Build and Retrieve' methodology to simultaneously solve cryo-EM structures of membrane proteins.
13	AFDB:Q51666	0.571	0.875	1.553E-5	167	0.165	0.257	Q51666.pdb.gz	Q51666_PARDE NorE protein OS=Paracoccus denitrificans OX=266 GN=norE PE=3 SV=1
14	AFDB:P0ABJ3	0.559	0.703	7.848E-5	204	0.184	0.235	P0ABJ3.pdb.gz	CYOC_ECOLI Cytochrome bo(3) ubiquinol oxidase subunit 3 OS=Escherichia coli (strain K12) OX=83333 GN=cyoC PE=1 SV=1
15	AFDB:Q9SMR9	0.322	0.208	3.099E-1	451	0.096	0.055	Q9SMR9.pdb.gz	Q9SMR9_ARATH Cell wall integrity/stress response component-like protein OS=Arabidopsis thaliana OX=3702 GN=At4g39840 PE=1 SV=1
16	PDB:1y4cA	0.289	0.169	7.268E-1	480	0.038	0.021	1y4cA.pdb.gz	De novo design of an IL-4 antagonist and its structure at 1.9 A.
17	PDB:3u8vA	0.248	0.696	7.952E-1	83	0.034	0.108	3u8vA.pdb.gz
18	PDB:6k5lA	0.156	0.089	1.140	565	0.061	0.028	6k5lA.pdb.gz	Characterization of metal binding of bifunctional kinase/phosphatase AceK and implication in activity modulation.
19	PDB:4o9uB	0.240	0.162	1.365	440	0.107	0.064	4o9uB.pdb.gz	Structural biology. Division of labor in transhydrogenase by alternating proton translocation and hydride transfer.
20	PDB:5jwyA	0.172	0.173	1.634	259	0.153	0.154	5jwyA.pdb.gz	Structural Insight into Substrate Selection and Catalysis of Lipid Phosphate Phosphatase PgpB in the Cell Membrane.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P00414	0.0	525	261	1.000	1.000	COX3_HUMAN Cytochrome c oxidase subunit 3 OS=Homo sapiens OX=9606 GN=MT-CO3 PE=1 SV=2
2	P00415	1.77e-169	470	261	0.877	0.877	COX3_BOVIN Cytochrome c oxidase subunit 3 OS=Bos taurus OX=9913 GN=MT-CO3 PE=1 SV=2
3	P00416	1.76e-148	417	261	0.870	0.870	COX3_MOUSE Cytochrome c oxidase subunit 3 OS=Mus musculus OX=10090 GN=mt-Co3 PE=1 SV=2
4	P18945	9.08e-140	395	261	0.751	0.751	COX3_CHICK Cytochrome c oxidase subunit 3 OS=Gallus gallus OX=9031 GN=MT-CO3 PE=3 SV=1
5	Q8HCR6	3.68e-104	305	280	0.594	0.554	Q8HCR6_ORYSJ Cytochrome c oxidase subunit 3 OS=Oryza sativa subsp. japonica OX=39947 GN=cox3 PE=3 SV=2
6	P14852	7.22e-104	304	265	0.594	0.585	COX3_ORYSI Cytochrome c oxidase subunit 3 OS=Oryza sativa subsp. indica OX=39946 GN=COX3 PE=3 SV=2
7	Q2F9A2	1.51e-103	304	280	0.594	0.554	Q2F9A2_ORYSI Cytochrome c oxidase subunit 3 OS=Oryza sativa subsp. indica OX=39946 GN=cox3 PE=3 SV=1
8	Q2F8Y5	1.21e-102	301	280	0.590	0.550	Q2F8Y5_ORYSJ Cytochrome c oxidase subunit 3 OS=Oryza sativa subsp. japonica OX=39947 GN=cox3 PE=3 SV=1
9	P14575	1.14e-81	248	269	0.498	0.483	COX3_SCHPO Cytochrome c oxidase subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cox3 PE=1 SV=4
10	P00420	2.16e-76	234	269	0.437	0.424	COX3_YEAST Cytochrome c oxidase subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COX3 PE=1 SV=3
11	P0ABJ3	7.22e-10	59.3	204	0.226	0.289	CYOC_ECOLI Cytochrome bo(3) ubiquinol oxidase subunit 3 OS=Escherichia coli (strain K12) OX=83333 GN=cyoC PE=1 SV=1
12	Q51666	0.47	33.1	167	0.126	0.198	Q51666_PARDE NorE protein OS=Paracoccus denitrificans OX=266 GN=norE PE=3 SV=1
13	Q9SRK7	4.6	31.2	579	0.107	0.048	AZG1_ARATH Adenine/guanine permease AZG1 OS=Arabidopsis thaliana OX=3702 GN=AZG1 PE=2 SV=1
14	Q86W10	5.4	30.8	505	0.073	0.038	CP4Z1_HUMAN Cytochrome P450 4Z1 OS=Homo sapiens OX=9606 GN=CYP4Z1 PE=1 SV=1
15	Q8IHY1	8.8	30.4	4226	0.050	0.003	GCYA_PLAF7 Guanylate cyclase alpha OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=GCalpha PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00510 COX3	2e-124	426.1	Cytochrome c oxidase subunit III

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354982

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354499	0.999	Cytochrome c oxidase subunit 1
2	9606.ENSP00000354554	0.999	Cytochrome b
3	9606.ENSP00000354876	0.999	Cytochrome c oxidase subunit 2
4	9606.ENSP00000317780	0.998	Cytochrome c oxidase subunit 5A, mitochondrial
5	9606.ENSP00000354632	0.998	ATP synthase subunit a
6	9606.ENSP00000354961	0.998	NADH-ubiquinone oxidoreductase chain 4
7	9606.ENSP00000425759	0.998	Cytochrome c oxidase subunit 7C, mitochondrial
8	9606.ENSP00000229379	0.997	Cytochrome c oxidase subunit 6A1, mitochondrial
9	9606.ENSP00000246554	0.997	Cytochrome c oxidase subunit 6B1
10	9606.ENSP00000258424	0.997	Cytochrome c oxidase subunit 5B, mitochondrial
11	9606.ENSP00000354687	0.997	NADH-ubiquinone oxidoreductase chain 1
12	9606.ENSP00000306397	0.993	Cytochrome b-c1 complex subunit Rieske, mitochondrial
13	9606.ENSP00000268379	0.990	Cytochrome b-c1 complex subunit 2, mitochondrial
14	9606.ENSP00000457513	0.990	Cytochrome c oxidase subunit 4 isoform 1, mitochondrial
15	9606.ENSP00000307786	0.987	Cytochrome c
16	9606.ENSP00000339720	0.982	Cytochrome c oxidase subunit NDUFA4
17	9606.ENSP00000355046	0.982	NADH-ubiquinone oxidoreductase chain 2
18	9606.ENSP00000355206	0.980	NADH-ubiquinone oxidoreductase chain 3
19	9606.ENSP00000428895	0.973	Cytochrome c oxidase subunit 6C
20	9606.ENSP00000354728	0.969	NADH-ubiquinone oxidoreductase chain 4L

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.855	catalytic activity
GO:0022857	0.778	transmembrane transporter activity
GO:0016491	0.765	oxidoreductase activity
GO:0009055	0.729	electron transfer activity
GO:0022804	0.716	active transmembrane transporter activity
GO:0015399	0.698	primary active transmembrane transporter activity
GO:0015453	0.681	oxidoreduction-driven active transmembrane transporter activity
GO:0016675	0.425	oxidoreductase activity, acting on a heme group of donors
GO:0008324	0.422	monoatomic cation transmembrane transporter activity
GO:0022890	0.421	inorganic cation transmembrane transporter activity
GO:0015078	0.357	proton transmembrane transporter activity
GO:0004129	0.315	cytochrome-c oxidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0065003	0.981	protein-containing complex assembly
GO:0017004	0.908	cytochrome complex assembly
GO:0008535	0.903	respiratory chain complex IV assembly
GO:0008152	0.818	metabolic process
GO:0044237	0.800	cellular metabolic process
GO:0006091	0.394	generation of precursor metabolites and energy
GO:0045333	0.371	cellular respiration

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0032991	0.986	protein-containing complex
GO:0016020	0.986	membrane
GO:0005746	0.951	mitochondrial respirasome
GO:0098800	0.950	inner mitochondrial membrane protein complex
GO:0098803	0.907	respiratory chain complex
GO:0070069	0.898	cytochrome complex
GO:0045277	0.596	respiratory chain complex IV
GO:0070013	0.427	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.765	Oxidoreductases.
EC:7.-.-.-	0.698	Translocases.
EC:1.9.-.-	0.425	Acting on a heme group of donors.
RHEA:11436	0.315	4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O
EC:7.1.1.9	0.315	cytochrome-c oxidase.

[back to server]