StarFunc result for job id P00450

User Input

>input (1065 residues)
MKILILGIFLFLCSTPAWAKEKHYYIGIIETTWDYASDHGEKKLISVDTEHSNIYLQNGP
DRIGRLYKKALYLQYTDETFRTTIEKPVWLGFLGPIIKAETGDKVYVHLKNLASRPYTFH
SHGITYYKEHEGAIYPDNTTDFQRADDKVYPGEQYTYMLLATEEQSPGEGDGNCVTRIYH
SHIDAPKDIASGLIGPLIICKKDSLDKEKEKHIDREFVVMFSVVDENFSWYLEDNIKTYC
SEPEKVDKDNEDFQESNRMYSVNGYTFGSLPGLSMCAEDRVKWYLFGMGNEVDVHAAFFH
GQALTNKNYRIDTINLFPATLFDAYMVAQNPGEWMLSCQNLNHLKAGLQAFFQVQECNKS
SSKDNIRGKHVRHYYIAAEEIIWNYAPSGIDIFTKENLTAPGSDSAVFFEQGTTRIGGSY
KKLVYREYTDASFTNRKERGPEEEHLGILGPVIWAEVGDTIRVTFHNKGAYPLSIEPIGV
RFNKNNEGTYYSPNYNPQSRSVPPSASHVAPTETFTYEWTVPKEVGPTNADPVCLAKMYY
SAVDPTKDIFTGLIGPMKICKKGSLHANGRQKDVDKEFYLFPTVFDENESLLLEDNIRMF
TTAPDQVDKEDEDFQESNKMHSMNGFMYGNQPGLTMCKGDSVVWYLFSAGNEADVHGIYF
SGNTYLWRGERRDTANLFPQTSLTLHMWPDTEGTFNVECLTTDHYTGGMKQKYTVNQCRR
QSEDSTFYLGERTYYIAAVEVEWDYSPQREWEKELHHLQEQNVSNAFLDKGEFYIGSKYK
KVVYRQYTDSTFRVPVERKAEEEHLGILGPQLHADVGDKVKIIFKNMATRPYSIHAHGVQ
TESSTVTPTLPGETLTYVWKIPERSGAGTEDSACIPWAYYSTVDQVKDLYSGLIGPLIVC
RRPYLKVFNPRRKLEFALLFLVFDENESWYLDDNIKTYSDHPEKVNKDDEEFIESNKMHA
INGRMFGNLQGLTMHVGDEVNWYLMGMGNEIDLHTVHFHGHSFQYKHRGVYSSDVFDIFP
GTYQTLEMFPRTPGIWLLHCHVTDHIHAGMETTYTVLQNEDTKSG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:1kcwA	0.949	0.993	0.000	1017	0.954	0.999	1kcwA.pdb.gz	The X-ray structure of human serum ceruloplasmin at 3.1 angstrom: Nature of the copper centres.
2	PDB:5n4lA	0.963	0.991	0.000	1034	0.810	0.835	5n4lA.pdb.gz	Rat ceruloplasmin: a new labile copper binding site and zinc/copper mosaic.
3	AFDB:A5PL27	0.996	0.996	0.000	1065	1.000	1.000	A5PL27.pdb.gz	A5PL27_HUMAN CP protein OS=Homo sapiens OX=9606 GN=CP PE=2 SV=1
4	AFDB:Q58L90	0.843	0.621	0.000	1460	0.334	0.244	Q58L90.pdb.gz	FA5V_OXYMI Venom prothrombin activator omicarin-C non-catalytic subunit OS=Oxyuranus microlepidotus OX=111177 PE=2 SV=1
5	AFDB:Q61147	0.987	0.990	0.000	1061	0.834	0.837	Q61147.pdb.gz	CERU_MOUSE Ceruloplasmin OS=Mus musculus OX=10090 GN=Cp PE=1 SV=2
6	AFDB:Q6MZM0	0.961	0.884	0.000	1159	0.507	0.466	Q6MZM0.pdb.gz	HPHL1_HUMAN Ferroxidase HEPHL1 OS=Homo sapiens OX=9606 GN=HEPHL1 PE=1 SV=2
7	AFDB:Q6P3G1	0.965	0.945	0.000	1087	0.552	0.541	Q6P3G1.pdb.gz
8	AFDB:Q90X47	0.865	0.446	0.000	2101	0.363	0.184	Q90X47.pdb.gz
9	AFDB:Q920H8	0.962	0.886	0.000	1157	0.489	0.450	Q920H8.pdb.gz	HEPH_RAT Hephaestin OS=Rattus norvegicus OX=10116 GN=Heph PE=1 SV=1
10	AFDB:Q9BQS7	0.962	0.885	0.000	1158	0.478	0.440	Q9BQS7.pdb.gz	HEPH_HUMAN Hephaestin OS=Homo sapiens OX=9606 GN=HEPH PE=1 SV=3
11	PDB:4bxsV	0.809	0.686	1.161E-103	1262	0.330	0.278	4bxsV.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
12	PDB:7kveB	0.805	0.630	7.305E-99	1374	0.343	0.266	7kveB.pdb.gz
13	AFDB:O88783	0.836	0.418	1.812E-95	2183	0.348	0.170	O88783.pdb.gz	FA5_MOUSE Coagulation factor V OS=Mus musculus OX=10090 GN=F5 PE=1 SV=1
14	AFDB:P00451	0.841	0.392	9.432E-95	2351	0.354	0.160	P00451.pdb.gz	FA8_HUMAN Coagulation factor VIII OS=Homo sapiens OX=9606 GN=F8 PE=1 SV=1
15	PDB:2dv6A	0.198	0.469	8.101E-20	422	0.070	0.178	2dv6A.pdb.gz	Structure and function of a hexameric copper-containing nitrite reductase.
16	PDB:5lwxA	0.190	0.345	9.105E-19	554	0.072	0.139	5lwxA.pdb.gz	Structure and function of Aspergillus niger laccase McoG
17	PDB:6im9A	0.197	0.395	6.591E-18	490	0.072	0.157	6im9A.pdb.gz
18	PDB:3qqxA	0.198	0.412	6.282E-17	474	0.074	0.167	3qqxA.pdb.gz	CueO E506D Mutant: Crystal Structure of Reduced Native Intermediate, Kinetics, and Impairment of Product Release
19	PDB:2yxvA	0.199	0.443	5.987E-16	444	0.069	0.167	2yxvA.pdb.gz	Structure and function of the engineered multicopper oxidase CueO from Escherichia coli--deletion of the methionine-rich helical region covering the substrate-binding site
20	PDB:3divA	0.191	0.382	6.325E-16	499	0.063	0.134	3divA.pdb.gz	Crystal Structure of laccase from Cerrena maxima at 1.76A resolution.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A5PL27	0.0	2237	1065	1.000	1.000	A5PL27_HUMAN CP protein OS=Homo sapiens OX=9606 GN=CP PE=2 SV=1
2	A8K5A4	0.0	2231	1065	0.996	0.996	A8K5A4_HUMAN cDNA FLJ76826, highly similar to Homo sapiens ceruloplasmin (ferroxidase) (CP), mRNA OS=Homo sapiens OX=9606 PE=2 SV=1
3	B3KTA8	0.0	1638	778	0.731	1.000	B3KTA8_HUMAN cDNA FLJ37971 fis, clone CTONG2009958, highly similar to CERULOPLASMIN OS=Homo sapiens OX=9606 PE=2 SV=1
4	P00450	0.0	2237	1065	1.000	1.000	CERU_HUMAN Ceruloplasmin OS=Homo sapiens OX=9606 GN=CP PE=1 SV=1
5	P13635	0.0	1838	1059	0.815	0.820	CERU_RAT Ceruloplasmin OS=Rattus norvegicus OX=10116 GN=Cp PE=1 SV=3
6	Q1L857	0.0	2110	1006	0.945	1.000	Q1L857_HUMAN Ceruloplasmin (Fragment) OS=Homo sapiens OX=9606 PE=3 SV=1
7	Q61147	0.0	1880	1061	0.834	0.837	CERU_MOUSE Ceruloplasmin OS=Mus musculus OX=10090 GN=Cp PE=1 SV=2
8	Q6MZM0	0.0	1115	1159	0.513	0.471	HPHL1_HUMAN Ferroxidase HEPHL1 OS=Homo sapiens OX=9606 GN=HEPHL1 PE=1 SV=2
9	Q7ZU12	0.0	1228	1087	0.555	0.544	Q7ZU12_DANRE Ceruloplasmin OS=Danio rerio OX=7955 GN=wu:fi23f10 PE=1 SV=1
10	Q920H8	0.0	1088	1157	0.499	0.459	HEPH_RAT Hephaestin OS=Rattus norvegicus OX=10116 GN=Heph PE=1 SV=1
11	Q9BQS7	0.0	1076	1158	0.485	0.446	HEPH_HUMAN Hephaestin OS=Homo sapiens OX=9606 GN=HEPH PE=1 SV=3
12	Q9Z0Z4	0.0	1091	1157	0.500	0.461	HEPH_MOUSE Hephaestin OS=Mus musculus OX=10090 GN=Heph PE=1 SV=3
13	B7ZVT7	1.76e-141	471	2087	0.244	0.125	B7ZVT7_DANRE Coagulation factor V OS=Danio rerio OX=7955 GN=si:bz20i5.3 PE=2 SV=1
14	P00451	3.60e-127	431	2351	0.245	0.111	FA8_HUMAN Coagulation factor VIII OS=Homo sapiens OX=9606 GN=F8 PE=1 SV=1
15	A0A0G2K3W2	2.01e-118	405	2259	0.223	0.105	A0A0G2K3W2_RAT Coagulation factor V OS=Rattus norvegicus OX=10116 GN=F5 PE=1 SV=2
16	O88783	1.83e-117	402	2183	0.222	0.108	FA5_MOUSE Coagulation factor V OS=Mus musculus OX=10090 GN=F5 PE=1 SV=1
17	Q7TN96	4.31e-117	401	2258	0.226	0.107	Q7TN96_RAT Factor VIII OS=Rattus norvegicus OX=10116 GN=F8 PE=2 SV=1
18	D3ZEB1	9.21e-117	400	2258	0.225	0.106	D3ZEB1_RAT Coagulation factor VIII OS=Rattus norvegicus OX=10116 GN=F8 PE=3 SV=4
19	Q7SZN0	6.69e-116	392	1460	0.215	0.157	FA5V_PSETE Venom prothrombin activator pseutarin-C non-catalytic subunit OS=Pseudonaja textilis OX=8673 PE=1 SV=1
20	Q58L90	1.46e-115	392	1460	0.214	0.156	FA5V_OXYMI Venom prothrombin activator omicarin-C non-catalytic subunit OS=Oxyuranus microlepidotus OX=111177 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00394 Cu-oxidase	1.4e-14	66.0	Multicopper oxidase
2	PF07731 Cu-oxidase_2	5.1e-28	109.0	Multicopper oxidase
3	PF07732 Cu-oxidase_3	4.6e-21	86.4	Multicopper oxidase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264613

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000225275	0.969	Myeloperoxidase
2	9606.ENSP00000261024	0.956	Solute carrier family 40 member 1
3	9606.ENSP00000216117	0.943	Heme oxygenase 1
4	9606.ENSP00000295897	0.927	Serum albumin
5	9606.ENSP00000372326	0.923	Ferrochelatase, mitochondrial
6	9606.ENSP00000242839	0.921	Copper-transporting ATPase 2
7	9606.ENSP00000477572	0.916	Heme oxygenase 2
8	9606.ENSP00000366482	0.909	Frataxin, mitochondrial
9	9606.ENSP00000348170	0.899	Haptoglobin
10	9606.ENSP00000345728	0.865	Copper-transporting ATPase 1
11	9606.ENSP00000416066	0.857	Alpha-1-antitrypsin
12	9606.ENSP00000430620	0.816	Hephaestin
13	9606.ENSP00000323929	0.806	Alpha-2-macroglobulin
14	9606.ENSP00000430598	0.801	Copper transport protein ATOX1
15	9606.ENSP00000306548	0.764	Mitochondrial ribosomal protein L13
16	9606.ENSP00000378364	0.762	Natural resistance-associated macrophage protein 2
17	9606.ENSP00000263408	0.750	Complement component C9
18	9606.ENSP00000331358	0.741	Gastrin
19	9606.ENSP00000265983	0.723	Hemopexin
20	9606.ENSP00000453302	0.720	Disintegrin and metalloproteinase domain-containing protein 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004322	1.000	ferroxidase activity
GO:0005515	0.996	protein binding
GO:0046872	0.978	metal ion binding
GO:0046914	0.968	transition metal ion binding
GO:0005507	0.923	copper ion binding
GO:0051087	0.337	chaperone binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050801	0.995	monoatomic ion homeostasis
GO:0055072	0.979	iron ion homeostasis
GO:0030003	0.976	intracellular monoatomic cation homeostasis
GO:0006879	0.974	intracellular iron ion homeostasis
GO:0065007	0.570	biological regulation
GO:0050896	0.529	response to stimulus
GO:0009987	0.471	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0031090	0.998	organelle membrane
GO:0005773	0.991	vacuole
GO:0005576	0.974	extracellular region
GO:0098588	0.970	bounding membrane of organelle
GO:0000323	0.965	lytic vacuole
GO:0005764	0.960	lysosome
GO:0005774	0.954	vacuolar membrane
GO:0012505	0.930	endomembrane system
GO:0098852	0.905	lytic vacuole membrane
GO:0070013	0.896	intracellular organelle lumen
GO:0070062	0.895	extracellular exosome
GO:0005765	0.891	lysosomal membrane
GO:0071944	0.417	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:11148	1.000	4 Fe(2+) + 4 H(+) + O2 = 4 Fe(3+) + 2 H2O
EC:1.16.3.1	1.000	ferroxidase.

[back to server]