StarFunc result for job id P00480

User Input

>input (354 residues)
MLFNLRILLNNAAFRNGHNFMVRNFRCGQPLQNKVQLKGRDLLTLKNFTGEEIKYMLWLS
ADLKFRIKQKGEYLPLLQGKSLGMIFEKRSTRTRLSTETGFALLGGHPCFLTTQDIHLGV
NESLTDTARVLSSMADAVLARVYKQSDLDTLAKEASIPIINGLSDLYHPIQILADYLTLQ
EHYSSLKGLTLSWIGDGNNILHSIMMSAAKFGMHLQAATPKGYEPDASVTKLAEQYAKEN
GTKLLLTNDPLEAAHGGNVLITDTWISMGQEEEKKKRLQAFQGYQVTMKTAKVAASDWTF
LHCLPRKPEEVDDEVFYSPRSLVFPEAENRKWTIMAVMVSLLTDYSPQLQKPKF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P00480	1.000	1.000	1.520E-73	354	1.000	1.000	P00480.pdb.gz	OTC_HUMAN Ornithine transcarbamylase, mitochondrial OS=Homo sapiens OX=9606 GN=OTC PE=1 SV=3
2	PDB:1c9yA	0.906	0.999	3.577E-66	321	0.904	0.997	1c9yA.pdb.gz	Crystal structure of human ornithine transcarbamylase complexed with carbamoyl phosphate and L-norvaline at 1.9 A resolution.
3	AFDB:Q9YHY9	0.917	0.917	3.333E-63	354	0.751	0.751	Q9YHY9.pdb.gz	OTC_CHICK Ornithine transcarbamylase, mitochondrial OS=Gallus gallus OX=9031 GN=OTC PE=1 SV=1
4	AFDB:P31317	0.850	0.919	1.893E-41	327	0.415	0.450	P31317.pdb.gz	OTC_SCHPO Ornithine carbamoyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=arg3 PE=1 SV=1
5	AFDB:Q4WNW5	0.826	0.789	5.142E-41	371	0.429	0.410	Q4WNW5.pdb.gz	Q4WNW5_ASPFU Ornithine carbamoyltransferase, mitochondrial OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_4G07190 PE=3 SV=1
6	AFDB:P05150	0.826	0.865	1.635E-38	338	0.345	0.361	P05150.pdb.gz	OTC_YEAST Ornithine carbamoyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARG3 PE=1 SV=1
7	AFDB:O50039	0.824	0.779	1.439E-37	375	0.381	0.360	O50039.pdb.gz	OTC_ARATH Ornithine transcarbamylase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=OTC PE=1 SV=2
8	AFDB:P08308	0.837	0.881	7.766E-35	336	0.356	0.375	P08308.pdb.gz	OTCC_PSEAE Ornithine carbamoyltransferase, catabolic OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=arcB PE=1 SV=3
9	PDB:7nnvA	0.808	0.926	2.473E-34	308	0.350	0.403	7nnvA.pdb.gz	A fragment-based approach to assess the ligandability of ArgB, ArgC, ArgD and ArgF in the L-arginine biosynthetic pathway of Mycobacterium tuberculosis
10	AFDB:P9WIT9	0.812	0.934	1.858E-33	307	0.356	0.410	P9WIT9.pdb.gz	OTC_MYCTU Ornithine carbamoyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=argF PE=1 SV=1
11	AFDB:P04391	0.837	0.886	1.293E-32	334	0.345	0.365	P04391.pdb.gz	OTC1_ECOLI Ornithine carbamoyltransferase subunit I OS=Escherichia coli (strain K12) OX=83333 GN=argI PE=1 SV=3
12	AFDB:P06960	0.838	0.887	2.618E-32	334	0.336	0.356	P06960.pdb.gz	OTC2_ECOLI Ornithine carbamoyltransferase subunit F OS=Escherichia coli (strain K12) OX=83333 GN=argF PE=1 SV=4
13	PDB:1dxhA	0.830	0.875	3.452E-32	335	0.350	0.370	1dxhA.pdb.gz
14	PDB:1duvG	0.840	0.891	4.912E-32	333	0.350	0.372	1duvG.pdb.gz	Mechanism of inactivation of ornithine transcarbamoylase by Ndelta -(N'-Sulfodiaminophosphinyl)-L-ornithine, a true transition state analogue? Crystal structure and implications for catalytic mechanism.
15	PDB:3kzkA	0.749	0.791	6.860E-24	334	0.260	0.275	3kzkA.pdb.gz	Crystal structure of N-acetylornithine transcarbamylase from Xanthomonas campestris: a novel enzyme in a new arginine biosynthetic pathway found in several eubacteria.
16	PDB:3csuA	0.691	0.835	1.594E-19	288	0.198	0.243	3csuA.pdb.gz
17	PDB:2a0fA	0.751	0.850	2.527E-18	310	0.206	0.235	2a0fA.pdb.gz	Structure of the E.coli Aspartate Transcarbamoylase Trapped in the Middle of the Catalytic Cycle.
18	PDB:5z1zC	0.246	0.268	3.201E-6	316	0.121	0.136	5z1zC.pdb.gz
19	PDB:4njmA	0.269	0.304	4.294E-6	303	0.088	0.102	4njmA.pdb.gz	Crystal structures and kinetics of Type III 3-phosphoglycerate dehydrogenase reveal catalysis by lysine.
20	PDB:2gcgA	0.250	0.266	8.199E-6	324	0.113	0.123	2gcgA.pdb.gz	Structural basis of substrate specificity in human glyoxylate reductase/hydroxypyruvate reductase

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P00480	0.0	738	354	1.000	1.000	OTC_HUMAN Ornithine transcarbamylase, mitochondrial OS=Homo sapiens OX=9606 GN=OTC PE=1 SV=3
2	P00481	0.0	680	354	0.918	0.918	OTC_RAT Ornithine transcarbamylase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Otc PE=1 SV=1
3	P11725	0.0	684	354	0.927	0.927	OTC_MOUSE Ornithine transcarbamylase, mitochondrial OS=Mus musculus OX=10090 GN=Otc PE=1 SV=1
4	Q9YHY9	0.0	565	354	0.751	0.751	OTC_CHICK Ornithine transcarbamylase, mitochondrial OS=Gallus gallus OX=9031 GN=OTC PE=1 SV=1
5	P31317	1.55e-103	309	327	0.415	0.450	OTC_SCHPO Ornithine carbamoyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=arg3 PE=1 SV=1
6	Q4WNW5	1.18e-95	291	371	0.427	0.407	Q4WNW5_ASPFU Ornithine carbamoyltransferase, mitochondrial OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_4G07190 PE=3 SV=1
7	P05150	1.75e-84	261	338	0.359	0.376	OTC_YEAST Ornithine carbamoyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARG3 PE=1 SV=1
8	O50039	3.84e-80	251	375	0.379	0.357	OTC_ARATH Ornithine transcarbamylase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=OTC PE=1 SV=2
9	P9WIT9	9.76e-70	222	307	0.356	0.410	OTC_MYCTU Ornithine carbamoyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=argF PE=1 SV=1
10	P08308	5.84e-65	211	336	0.356	0.375	OTCC_PSEAE Ornithine carbamoyltransferase, catabolic OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=arcB PE=1 SV=3
11	P04391	1.51e-59	197	334	0.347	0.368	OTC1_ECOLI Ornithine carbamoyltransferase subunit I OS=Escherichia coli (strain K12) OX=83333 GN=argI PE=1 SV=3
12	P06960	3.13e-56	188	334	0.336	0.356	OTC2_ECOLI Ornithine carbamoyltransferase subunit F OS=Escherichia coli (strain K12) OX=83333 GN=argF PE=1 SV=4
13	Q8P8J2	3.43e-22	97.8	339	0.246	0.257	AOTC_XANCP N-acetylornithine carbamoyltransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=argF' PE=1 SV=1
14	A0A8I5Y665	1.45e-20	95.5	2304	0.229	0.035	A0A8I5Y665_RAT CAD protein OS=Rattus norvegicus OX=10116 GN=Cad PE=3 SV=1
15	D4A8A0	1.48e-20	95.5	2162	0.229	0.037	D4A8A0_RAT CAD protein OS=Rattus norvegicus OX=10116 GN=Cad PE=1 SV=3
16	A0A8I5ZMM2	1.53e-20	95.5	2321	0.229	0.035	A0A8I5ZMM2_RAT CAD protein OS=Rattus norvegicus OX=10116 GN=Cad PE=1 SV=1
17	U3JAV8	2.15e-20	95.1	2230	0.223	0.035	U3JAV8_DANRE CAD protein OS=Danio rerio OX=7955 GN=cb456 PE=1 SV=1
18	B2RQC6	2.31e-20	95.1	2225	0.232	0.037	PYR1_MOUSE CAD protein OS=Mus musculus OX=10090 GN=Cad PE=1 SV=1
19	P27708	2.68e-20	94.7	2225	0.223	0.036	PYR1_HUMAN CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3
20	F8VPD4	2.80e-20	94.7	2162	0.223	0.037	F8VPD4_HUMAN CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00185 OTCace	3.7e-48	175.0	Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
2	PF02729 OTCace_N	3.6e-40	148.9	Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000039007

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361471	0.999	Argininosuccinate synthase
2	9606.ENSP00000402608	0.991	Carbamoyl-phosphate synthase [ammonia], mitochondrial
3	9606.ENSP00000293404	0.989	N-acetylglutamate synthase, mitochondrial
4	9606.ENSP00000261783	0.986	Arginase-2, mitochondrial
5	9606.ENSP00000349446	0.985	Arginase-1
6	9606.ENSP00000307188	0.979	Argininosuccinate lyase
7	9606.ENSP00000357838	0.955	Ornithine aminotransferase, mitochondrial
8	9606.ENSP00000384296	0.948	Aminoacylase-1
9	9606.ENSP00000327251	0.931	Nitric oxide synthase, inducible
10	9606.ENSP00000477999	0.927	Nitric oxide synthase, brain
11	9606.ENSP00000297494	0.926	Nitric oxide synthase, endothelial
12	9606.ENSP00000249269	0.906	Mitochondrial-processing peptidase subunit beta
13	9606.ENSP00000360782	0.904	Mitochondrial-processing peptidase subunit alpha
14	9606.ENSP00000370377	0.900	Presequence protease, mitochondrial
15	9606.ENSP00000396527	0.899	annotation not available
16	9606.ENSP00000264705	0.879	CAD protein
17	9606.ENSP00000356256	0.759	Mitochondrial import inner membrane translocase subunit Tim17-A
18	9606.ENSP00000297185	0.735	Stress-70 protein, mitochondrial
19	9606.ENSP00000360268	0.728	Delta-1-pyrroline-5-carboxylate synthase
20	9606.ENSP00000410833	0.719	1,4-alpha-glucan-branching enzyme

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004585	1.000	ornithine carbamoyltransferase activity
GO:0005488	0.944	binding
GO:0005515	0.890	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0071941	0.992	nitrogen cycle metabolic process
GO:0006520	0.985	amino acid metabolic process
GO:1901607	0.975	alpha-amino acid biosynthetic process
GO:0006591	0.914	ornithine metabolic process
GO:0034641	0.890	cellular nitrogen compound metabolic process
GO:0044271	0.863	cellular nitrogen compound biosynthetic process
GO:0042592	0.821	homeostatic process
GO:0043604	0.753	amide biosynthetic process
GO:0009056	0.348	catabolic process
GO:1901575	0.336	organic substance catabolic process
GO:0048878	0.313	chemical homeostasis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.997	intracellular organelle lumen
GO:0016020	0.990	membrane
GO:0031090	0.979	organelle membrane
GO:0005759	0.860	mitochondrial matrix
GO:0031966	0.557	mitochondrial membrane
GO:0019866	0.537	organelle inner membrane
GO:0005743	0.528	mitochondrial inner membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19513	1.000	carbamoyl phosphate + L-ornithine = H(+) + L-citrulline + phosphate
EC:2.1.3.3	1.000	ornithine carbamoyltransferase.

[back to server]