StarFunc result for job id P00491

User Input

>input (289 residues)
MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRST
VPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGL
NPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQ
MGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSL
ITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P55859	0.990	0.990	1.825E-57	289	0.865	0.865	P55859.pdb.gz	PNPH_BOVIN Purine nucleoside phosphorylase OS=Bos taurus OX=9913 GN=PNP PE=1 SV=3
2	AFDB:P85973	0.991	0.991	7.925E-56	289	0.851	0.851	P85973.pdb.gz	PNPH_RAT Purine nucleoside phosphorylase OS=Rattus norvegicus OX=10116 GN=Pnp PE=1 SV=1
3	AFDB:P23492	0.986	0.986	7.013E-55	289	0.841	0.841	P23492.pdb.gz	PNPH_MOUSE Purine nucleoside phosphorylase OS=Mus musculus OX=10090 GN=Pnp PE=1 SV=2
4	PDB:1a9oA	0.966	0.966	8.584E-51	289	0.862	0.862	1a9oA.pdb.gz	Calf spleen purine nucleoside phosphorylase complexed with substrates and substrate analogues.
5	PDB:1ulaA	0.953	0.953	8.584E-51	289	0.997	0.997	1ulaA.pdb.gz
6	AFDB:Q05788	0.930	0.866	5.160E-39	311	0.478	0.444	Q05788.pdb.gz	PNPH_YEAST Purine nucleoside phosphorylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PNP1 PE=1 SV=1
7	AFDB:Q6FNV3	0.933	0.859	6.927E-39	315	0.467	0.429	Q6FNV3.pdb.gz	Q6FNV3_CANGA Purine nucleoside phosphorylase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0J08800g PE=3 SV=1
8	AFDB:U4PSA1	0.941	0.856	2.122E-38	318	0.433	0.393	U4PSA1.pdb.gz	U4PSA1_CAEEL Purine nucleoside phosphorylase OS=Caenorhabditis elegans OX=6239 GN=pnp-1 PE=1 SV=1
9	AFDB:Q9UTG1	0.915	0.841	6.130E-38	315	0.471	0.432	Q9UTG1.pdb.gz	PNPH_SCHPO Putative purine nucleoside phosphorylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1805.16c PE=3 SV=1
10	AFDB:P45563	0.895	0.933	3.951E-32	277	0.398	0.415	P45563.pdb.gz	XAPA_ECOLI Purine nucleoside phosphorylase 2 OS=Escherichia coli (strain K12) OX=83333 GN=xapA PE=1 SV=2
11	PDB:1yqqA	0.897	0.948	5.490E-30	273	0.394	0.418	1yqqA.pdb.gz	Escherichia coli Purine Nucleoside Phosphorylase II, the Product of the xapA Gene
12	AFDB:P9WP01	0.863	0.928	1.273E-29	268	0.349	0.377	P9WP01.pdb.gz	PUNA_MYCTU Purine nucleoside phosphorylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=punA PE=1 SV=1
13	AFDB:G3V5M2	0.620	0.809	1.419E-27	221	0.616	0.805	G3V5M2.pdb.gz	G3V5M2_HUMAN Purine nucleoside phosphorylase OS=Homo sapiens OX=9606 GN=PNP PE=1 SV=2
14	PDB:1i80A	0.816	0.884	7.714E-27	266	0.349	0.380	1i80A.pdb.gz	Structures of purine nucleoside phosphorylase from Mycobacterium tuberculosis in complexes with immucillin-H and its pieces.
15	PDB:5tc5A	0.715	0.722	6.925E-16	286	0.235	0.238	5tc5A.pdb.gz	TBA
16	PDB:1a69A	0.585	0.697	1.028E-11	237	0.142	0.173	1a69A.pdb.gz	Crystal structure of the ternary complex of E. coli purine nucleoside phosphorylase with formycin B, a structural analogue of the substrate inosine, and phosphate (Sulphate) at 2.1 A resolution.
17	PDB:1u1cA	0.570	0.642	3.340E-11	253	0.128	0.146	1u1cA.pdb.gz	Structural basis for inhibition of Escherichia coli uridine phosphorylase by 5-substituted acyclouridines.
18	PDB:3emvA	0.540	0.625	7.184E-11	246	0.104	0.122	3emvA.pdb.gz
19	PDB:1nc3A	0.592	0.712	1.844E-10	235	0.145	0.179	1nc3A.pdb.gz	Structure of Escherichia coli 5'-methylthioadenosine/ S-adenosylhomocysteine nucleosidase inhibitor complexes provide insight into the conformational changes required for substrate binding and catalysis.
20	PDB:4txjB	0.509	0.506	5.022E-10	291	0.135	0.134	4txjB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G3V5M2	0.0	598	328	0.986	0.869	G3V5M2_HUMAN Purine nucleoside phosphorylase OS=Homo sapiens OX=9606 GN=PNP PE=1 SV=2
2	P00491	0.0	605	289	1.000	1.000	PNPH_HUMAN Purine nucleoside phosphorylase OS=Homo sapiens OX=9606 GN=PNP PE=1 SV=2
3	P23492	0.0	514	289	0.841	0.841	PNPH_MOUSE Purine nucleoside phosphorylase OS=Mus musculus OX=10090 GN=Pnp PE=1 SV=2
4	P55859	0.0	530	289	0.865	0.865	PNPH_BOVIN Purine nucleoside phosphorylase OS=Bos taurus OX=9913 GN=PNP PE=1 SV=3
5	P85973	0.0	517	289	0.851	0.851	PNPH_RAT Purine nucleoside phosphorylase OS=Rattus norvegicus OX=10116 GN=Pnp PE=1 SV=1
6	V9HWH6	0.0	605	289	1.000	1.000	V9HWH6_HUMAN Purine nucleoside phosphorylase OS=Homo sapiens OX=9606 GN=HEL-S-156an PE=2 SV=1
7	Q05788	3.15e-91	275	311	0.484	0.450	PNPH_YEAST Purine nucleoside phosphorylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PNP1 PE=1 SV=1
8	Q9UTG1	6.90e-88	266	315	0.464	0.425	PNPH_SCHPO Putative purine nucleoside phosphorylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1805.16c PE=3 SV=1
9	Q6FNV3	2.64e-85	259	315	0.457	0.419	Q6FNV3_CANGA Purine nucleoside phosphorylase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0J08800g PE=3 SV=1
10	U4PSA1	2.58e-80	247	318	0.426	0.387	U4PSA1_CAEEL Purine nucleoside phosphorylase OS=Caenorhabditis elegans OX=6239 GN=pnp-1 PE=1 SV=1
11	P45563	2.78e-63	202	277	0.394	0.412	XAPA_ECOLI Purine nucleoside phosphorylase 2 OS=Escherichia coli (strain K12) OX=83333 GN=xapA PE=1 SV=2
12	P9WP01	1.43e-44	154	268	0.353	0.381	PUNA_MYCTU Purine nucleoside phosphorylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=punA PE=1 SV=1
13	Q9CQ65	1.26e-15	77.4	283	0.221	0.226	MTAP_MOUSE S-methyl-5'-thioadenosine phosphorylase OS=Mus musculus OX=10090 GN=Mtap PE=1 SV=1
14	B4DUC8	1.65e-15	77.4	300	0.242	0.233	B4DUC8_HUMAN S-methyl-5'-thioadenosine phosphorylase OS=Homo sapiens OX=9606 GN=MTAP PE=1 SV=1
15	A0A384ME80	3.72e-15	75.9	283	0.221	0.226	A0A384ME80_HUMAN S-methyl-5'-thioadenosine phosphorylase OS=Homo sapiens OX=9606 GN=MTAP PE=2 SV=1
16	Q13126	3.72e-15	75.9	283	0.221	0.226	MTAP_HUMAN S-methyl-5'-thioadenosine phosphorylase OS=Homo sapiens OX=9606 GN=MTAP PE=1 SV=2
17	A0A0G2K583	3.94e-15	75.9	283	0.218	0.223	A0A0G2K583_RAT S-methyl-5'-thioadenosine phosphorylase OS=Rattus norvegicus OX=10116 GN=Mtap PE=1 SV=1
18	Q9V813	1.39e-09	60.1	289	0.228	0.228	MTAP_DROME S-methyl-5'-thioadenosine phosphorylase OS=Drosophila melanogaster OX=7227 GN=Mtap PE=1 SV=1
19	A0A8I5ZXI1	7.57e-08	55.1	367	0.138	0.109	A0A8I5ZXI1_RAT S-methyl-5'-thioadenosine phosphorylase OS=Rattus norvegicus OX=10116 GN=Mtap PE=1 SV=1
20	Q7TP15	1.21e-07	54.7	391	0.138	0.102	Q7TP15_RAT S-methyl-5'-thioadenosine phosphorylase OS=Rattus norvegicus OX=10116 GN=Mtap PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01048 PNP_UDP_1	1.2e-47	173.8	Phosphorylase superfamily

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354532

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361965	0.990	Adenosine deaminase
2	9606.ENSP00000238018	0.983	Guanine deaminase
3	9606.ENSP00000367615	0.983	Adenine phosphoribosyltransferase
4	9606.ENSP00000286621	0.981	Adenosine kinase
5	9606.ENSP00000298556	0.976	Hypoxanthine-guanine phosphoribosyltransferase
6	9606.ENSP00000330032	0.973	Uridine phosphorylase 1
7	9606.ENSP00000382731	0.963	Adenosine deaminase 2
8	9606.ENSP00000364212	0.962	Cytidine deaminase
9	9606.ENSP00000362481	0.961	Uracil phosphoribosyltransferase homolog
10	9606.ENSP00000354387	0.959	Nicotinamide riboside kinase 1
11	9606.ENSP00000371393	0.959	Phosphoglucomutase-2
12	9606.ENSP00000401508	0.959	Nicotinate phosphoribosyltransferase
13	9606.ENSP00000359211	0.957	Dihydropyrimidine dehydrogenase [NADP(+)]
14	9606.ENSP00000286648	0.954	Deoxycytidine kinase
15	9606.ENSP00000474090	0.954	Uridine phosphorylase 2
16	9606.ENSP00000368727	0.950	Xanthine dehydrogenase/oxidase
17	9606.ENSP00000339479	0.947	Cytosolic purine 5'-nucleotidase
18	9606.ENSP00000264093	0.944	Deoxyguanosine kinase, mitochondrial
19	9606.ENSP00000222553	0.942	Nicotinamide phosphoribosyltransferase
20	9606.ENSP00000301634	0.942	Thymidine kinase, cytosolic

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004731	1.000	purine-nucleoside phosphorylase activity
GO:0005488	0.957	binding
GO:0005515	0.928	protein binding
GO:0042802	0.730	identical protein binding
GO:0016787	0.569	hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1901657	0.996	glycosyl compound metabolic process
GO:0072521	0.995	purine-containing compound metabolic process
GO:0055086	0.995	nucleobase-containing small molecule metabolic process
GO:0042278	0.994	purine nucleoside metabolic process
GO:0072522	0.993	purine-containing compound biosynthetic process
GO:0034654	0.991	nucleobase-containing compound biosynthetic process
GO:0043094	0.990	cellular metabolic compound salvage
GO:0009117	0.959	nucleotide metabolic process
GO:0009123	0.947	nucleoside monophosphate metabolic process
GO:0006163	0.941	purine nucleotide metabolic process
GO:0043101	0.938	purine-containing compound salvage
GO:0034656	0.930	nucleobase-containing small molecule catabolic process
GO:1901136	0.927	carbohydrate derivative catabolic process
GO:0009150	0.925	purine ribonucleotide metabolic process
GO:1901293	0.924	nucleoside phosphate biosynthetic process
GO:0009165	0.914	nucleotide biosynthetic process
GO:0009166	0.884	nucleotide catabolic process
GO:0009161	0.876	ribonucleoside monophosphate metabolic process
GO:0009126	0.870	purine nucleoside monophosphate metabolic process
GO:0009119	0.860	ribonucleoside metabolic process
GO:0009261	0.846	ribonucleotide catabolic process
GO:0009167	0.842	purine ribonucleoside monophosphate metabolic process
GO:1901565	0.833	organonitrogen compound catabolic process
GO:0009164	0.820	nucleoside catabolic process
GO:0072523	0.805	purine-containing compound catabolic process
GO:0046128	0.788	purine ribonucleoside metabolic process
GO:0042454	0.768	ribonucleoside catabolic process
GO:0050794	0.679	regulation of cellular process
GO:0050896	0.510	response to stimulus
GO:0048518	0.446	positive regulation of biological process
GO:0048522	0.440	positive regulation of cellular process
GO:0019692	0.392	deoxyribose phosphate metabolic process
GO:0009394	0.374	2'-deoxyribonucleotide metabolic process
GO:0006195	0.372	purine nucleotide catabolic process
GO:0019222	0.308	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043227	0.917	membrane-bounded organelle
GO:0005576	0.854	extracellular region
GO:0043231	0.836	intracellular membrane-bounded organelle
GO:0043233	0.570	organelle lumen
GO:0070013	0.561	intracellular organelle lumen
GO:0005634	0.328	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19805	1.000	a purine D-ribonucleoside + phosphate = a purine nucleobase + alpha-D-ribose 1-phosphate
EC:2.4.2.1	1.000	purine-nucleoside phosphorylase.
EC:3.-.-.-	0.569	Hydrolases.

[back to server]