StarFunc result for job id P00492

User Input

>input (218 residues)
MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGH
HIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGD
DLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVG
FEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A140VJL3	0.997	0.997	6.869E-47	218	1.000	1.000	A0A140VJL3.pdb.gz	A0A140VJL3_HUMAN Hypoxanthine phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=HPRT1 PE=2 SV=1
2	PDB:1bzyA	0.932	0.950	6.843E-41	214	0.982	1.000	1bzyA.pdb.gz	The 2.0 A structure of human hypoxanthine-guanine phosphoribosyltransferase in complex with a transition-state analog inhibitor.
3	AFDB:Q9NRG1	0.957	0.928	6.054E-37	225	0.661	0.640	Q9NRG1.pdb.gz	PRDC1_HUMAN Phosphoribosyltransferase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PRTFDC1 PE=1 SV=1
4	PDB:5brnB	0.879	0.987	5.067E-36	194	0.881	0.990	5brnB.pdb.gz	Synthesis and Evaluation of Novel Acyclic Nucleoside Phosphonates as Inhibitors of Plasmodium falciparum and Human 6-Oxopurine Phosphoribosyltransferases.
5	PDB:2jbhB	0.931	0.953	1.189E-33	213	0.647	0.662	2jbhB.pdb.gz	Structural and Functional Studies of the Human Phosphoribosyltransferase Domain Containing Protein 1.
6	AFDB:Q8IJS1	0.905	0.855	1.129E-28	231	0.491	0.463	Q8IJS1.pdb.gz	Q8IJS1_PLAF7 Hypoxanthine phosphoribosyltransferase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1012400 PE=3 SV=1
7	AFDB:Q9NF11	0.911	0.927	6.375E-27	214	0.486	0.495	Q9NF11.pdb.gz	Q9NF11_CAEEL Hypoxanthine phosphoribosyltransferase OS=Caenorhabditis elegans OX=6239 GN=hprt-1 PE=1 SV=1
8	PDB:5knyB	0.687	0.795	1.189E-17	187	0.271	0.316	5knyB.pdb.gz	Crystal structure of Mycobacterium tuberculosis hypoxanthine guanine phosphoribosyltransferase in complex with pyrrolidine nucleoside phosphonate
9	AFDB:Q38CA1	0.785	0.736	1.715E-17	234	0.312	0.291	Q38CA1.pdb.gz	Q38CA1_TRYB2 Hypoxanthine-guanine phosphoribosyltransferase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.6660 PE=1 SV=1
10	AFDB:P9WHQ9	0.714	0.767	1.932E-17	202	0.284	0.307	P9WHQ9.pdb.gz	HGPRT_MYCTU Hypoxanthine-guanine phosphoribosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=hpt PE=1 SV=1
11	AFDB:Q07010	0.761	0.789	3.710E-17	210	0.220	0.229	Q07010.pdb.gz	HPRT_TRYBB Hypoxanthine-guanine phosphoribosyltransferase OS=Trypanosoma brucei brucei OX=5702 GN=HGPRT PE=1 SV=1
12	AFDB:F4IA25	0.723	0.792	5.619E-17	198	0.280	0.308	F4IA25.pdb.gz	F4IA25_ARATH Hypoxanthine phosphoribosyltransferase OS=Arabidopsis thaliana OX=3702 GN=HGPT PE=1 SV=1
13	AFDB:P0A9M2	0.702	0.853	5.619E-17	178	0.275	0.337	P0A9M2.pdb.gz	HPRT_ECOLI Hypoxanthine phosphoribosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=hpt PE=1 SV=1
14	PDB:6mxcC	0.735	0.728	6.640E-17	220	0.280	0.277	6mxcC.pdb.gz	Crystal structures of Trypanosoma brucei hypoxanthine - guanine - xanthine phosphoribosyltransferase in complex with IMP, GMP and XMP.
15	AFDB:Q4QCC3	0.735	0.758	8.022E-17	211	0.248	0.256	Q4QCC3.pdb.gz	Q4QCC3_LEIMA Hypoxanthine phosphoribosyltransferase OS=Leishmania major OX=5664 GN=HGPRT PE=3 SV=1
16	PDB:5knxB	0.693	0.851	1.067E-16	176	0.271	0.335	5knxB.pdb.gz	Crystal Structures of Acyclic Nucleoside Phosphonates in Complex with Escherichia coli Hypoxanthine Phosphoribosyltransferase
17	PDB:6apsA	0.687	0.803	5.746E-14	185	0.202	0.238	6apsA.pdb.gz	Evaluation of the Trypanosoma brucei 6-oxopurine salvage pathway as a potential target for drug discovery.
18	PDB:1w30B	0.579	0.700	1.968E-9	177	0.142	0.175	1w30B.pdb.gz
19	PDB:1a95B	0.422	0.577	9.983E-7	150	0.128	0.187	1a95B.pdb.gz	Structures of free and complexed forms of Escherichia coli xanthine-guanine phosphoribosyltransferase.
20	PDB:2jkyA	0.454	0.476	9.513E-6	207	0.119	0.126	2jkyA.pdb.gz	Functional Significance of Four Successive Glycine Residues in the Pyrophosphate Binding Loop of Fungal 6-Oxopurine Phosphoribosyltransferases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A140VJL3	9.23e-162	447	218	1.000	1.000	A0A140VJL3_HUMAN Hypoxanthine phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=HPRT1 PE=2 SV=1
2	P00492	9.23e-162	447	218	1.000	1.000	HPRT_HUMAN Hypoxanthine-guanine phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=HPRT1 PE=1 SV=2
3	P00493	7.48e-157	434	218	0.968	0.968	HPRT_MOUSE Hypoxanthine-guanine phosphoribosyltransferase OS=Mus musculus OX=10090 GN=Hprt1 PE=1 SV=3
4	P27605	4.83e-155	430	218	0.954	0.954	HPRT_RAT Hypoxanthine-guanine phosphoribosyltransferase OS=Rattus norvegicus OX=10116 GN=Hprt1 PE=1 SV=1
5	Q9W719	4.00e-149	415	218	0.908	0.908	HPRT_CHICK Hypoxanthine-guanine phosphoribosyltransferase OS=Gallus gallus OX=9031 GN=HPRT1 PE=2 SV=1
6	Q9NRG1	7.22e-106	306	225	0.661	0.640	PRDC1_HUMAN Phosphoribosyltransferase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PRTFDC1 PE=1 SV=1
7	Q8IJS1	1.17e-66	206	231	0.482	0.455	Q8IJS1_PLAF7 Hypoxanthine phosphoribosyltransferase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1012400 PE=3 SV=1
8	Q9NF11	6.46e-62	194	214	0.477	0.486	Q9NF11_CAEEL Hypoxanthine phosphoribosyltransferase OS=Caenorhabditis elegans OX=6239 GN=hprt-1 PE=1 SV=1
9	Q38CA1	1.95e-28	108	234	0.280	0.261	Q38CA1_TRYB2 Hypoxanthine-guanine phosphoribosyltransferase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.6660 PE=1 SV=1
10	Q4QCC2	6.45e-26	102	238	0.252	0.231	Q4QCC2_LEIMA Xanthine phosphoribosyltransferase OS=Leishmania major OX=5664 GN=XRPT PE=4 SV=1
11	P0A9M2	1.36e-24	97.4	178	0.275	0.337	HPRT_ECOLI Hypoxanthine phosphoribosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=hpt PE=1 SV=1
12	Q4QCC3	2.41e-21	89.7	211	0.234	0.242	Q4QCC3_LEIMA Hypoxanthine phosphoribosyltransferase OS=Leishmania major OX=5664 GN=HGPRT PE=3 SV=1
13	F4IA25	3.23e-19	84.0	198	0.266	0.293	F4IA25_ARATH Hypoxanthine phosphoribosyltransferase OS=Arabidopsis thaliana OX=3702 GN=HGPT PE=1 SV=1
14	Q07010	4.49e-19	83.6	210	0.216	0.224	HPRT_TRYBB Hypoxanthine-guanine phosphoribosyltransferase OS=Trypanosoma brucei brucei OX=5702 GN=HGPRT PE=1 SV=1
15	P9WHQ9	2.60e-17	79.0	202	0.257	0.277	HGPRT_MYCTU Hypoxanthine-guanine phosphoribosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=hpt PE=1 SV=1
16	P65946	0.023	37.0	173	0.115	0.145	PYRR_STRPN Bifunctional protein PyrR OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=pyrR PE=1 SV=1
17	A0A1I4KS07	0.29	34.3	341	0.128	0.082	TCPO_METOL Probable 2' cyclic ADP-D-ribose synthase TcpO OS=Methanobrevibacter olleyae OX=294671 GN=tcpO PE=1 SV=1
18	O83089	1.2	32.0	202	0.138	0.149	O83089_TREPA Phosphoribosyltransferase domain-containing protein OS=Treponema pallidum (strain Nichols) OX=243276 GN=TP_0050 PE=1 SV=1
19	G5EEE1	2.6	31.2	392	0.151	0.084	FUTE_CAEEL Alpha-(1,3)-fucosyltransferase fut-6 OS=Caenorhabditis elegans OX=6239 GN=fut-6 PE=1 SV=1
20	Q3TTY0	2.8	31.6	1478	0.124	0.018	PLB1_MOUSE Phospholipase B1, membrane-associated OS=Mus musculus OX=10090 GN=Plb1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00156 Pribosyltran	3.4e-21	86.7	Phosphoribosyl transferase domain
2	PF15609 PRTase_2	4.7e+02	11.7	Phosphoribosyl transferase
3	PF14681 UPRTase	1.3e+02	13.5	Uracil phosphoribosyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000002427

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000017317	0.995	Guanylate kinase 1
2	61853.ENSNLEP00000013361	0.994	Purine nucleoside phosphorylase
3	61853.ENSNLEP00000004834	0.992	Adenylosuccinate synthetase isozyme 2
4	61853.ENSNLEP00000019807	0.992	Adenylosuccinate synthetase isozyme 1
5	61853.ENSNLEP00000008217	0.988	Inosine-5'-monophosphate dehydrogenase
6	61853.ENSNLEP00000001235	0.963	GMP reductase
7	61853.ENSNLEP00000001245	0.949	Catalyzes the hydrolytic deamination of guanine, producing xanthine and ammonia
8	61853.ENSNLEP00000004717	0.945	Guanine monphosphate synthase
9	61853.ENSNLEP00000018947	0.943	Adenine phosphoribosyltransferase
10	61853.ENSNLEP00000008808	0.938	5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase
11	61853.ENSNLEP00000003812	0.937	AMP deaminase
12	61853.ENSNLEP00000005836	0.937	AMP deaminase
13	61853.ENSNLEP00000021355	0.937	AMP deaminase
14	61853.ENSNLEP00000001873	0.924	Thiopurine S-methyltransferase
15	61853.ENSNLEP00000002386	0.905	Uncharacterized protein
16	61853.ENSNLEP00000018486	0.905	5'-nucleotidase, cytosolic II
17	61853.ENSNLEP00000015555	0.904	5'-nucleotidase, ecto (CD73)
18	61853.ENSNLEP00000000164	0.902	Calcium activated nucleotidase 1
19	61853.ENSNLEP00000018709	0.902	5'-nucleotidase, cytosolic IIIA
20	61853.ENSNLEP00000011210	0.901	Ectonucleoside triphosphate diphosphohydrolase 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004422	1.000	hypoxanthine phosphoribosyltransferase activity
GO:0042802	0.996	identical protein binding
GO:0043167	0.962	ion binding
GO:0043169	0.922	cation binding
GO:0000287	0.770	magnesium ion binding
GO:0097159	0.647	organic cyclic compound binding
GO:1901363	0.643	heterocyclic compound binding
GO:0052657	0.486	guanine phosphoribosyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0055086	0.987	nucleobase-containing small molecule metabolic process
GO:1901135	0.934	carbohydrate derivative metabolic process
GO:0009123	0.926	nucleoside monophosphate metabolic process
GO:0009167	0.920	purine ribonucleoside monophosphate metabolic process
GO:0009116	0.919	nucleoside metabolic process
GO:0009112	0.915	nucleobase metabolic process
GO:0046128	0.914	purine ribonucleoside metabolic process
GO:0043101	0.911	purine-containing compound salvage
GO:0009117	0.907	nucleotide metabolic process
GO:0009156	0.905	ribonucleoside monophosphate biosynthetic process
GO:0009150	0.900	purine ribonucleotide metabolic process
GO:0009168	0.896	purine ribonucleoside monophosphate biosynthetic process
GO:0006144	0.888	purine nucleobase metabolic process
GO:0009152	0.779	purine ribonucleotide biosynthetic process
GO:0046040	0.732	IMP metabolic process
GO:0050896	0.715	response to stimulus
GO:0046037	0.677	GMP metabolic process
GO:0065007	0.662	biological regulation
GO:0043173	0.583	nucleotide salvage
GO:0032501	0.555	multicellular organismal process
GO:0050789	0.512	regulation of biological process
GO:0032502	0.455	developmental process
GO:0048856	0.445	anatomical structure development
GO:0042221	0.428	response to chemical
GO:0050794	0.422	regulation of cellular process
GO:0010033	0.336	response to organic substance
GO:0051716	0.327	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043226	0.945	organelle
GO:0043227	0.875	membrane-bounded organelle
GO:0043229	0.797	intracellular organelle
GO:0043231	0.786	intracellular membrane-bounded organelle
GO:1903561	0.412	extracellular vesicle
GO:0070062	0.328	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:17973	1.000	diphosphate + IMP = 5-phospho-alpha-D-ribose 1-diphosphate + hypoxanthine
EC:2.4.2.8	1.000	hypoxanthine phosphoribosyltransferase.
RHEA:25424	0.486	diphosphate + GMP = 5-phospho-alpha-D-ribose 1-diphosphate + guanine

[back to server]