StarFunc result for job id P00505

User Input

>input (430 residues)
MALLHSGRVLPGIAAAFHPGLAAAASARASSWWTHVEMGPPDPILGVTEAFKRDTNSKKM
NLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEV
LKSGRFVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYR
YYDPKTCGFDFTGAVEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFA
FFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADE
AKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKVMADRIIGMRTQLVS
NLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGY
LAHAIHQVTK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P00505	1.000	1.000	1.407E-81	430	1.000	1.000	P00505.pdb.gz	AATM_HUMAN Aspartate aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=GOT2 PE=1 SV=3
2	AFDB:P00508	0.952	0.968	3.914E-72	423	0.833	0.846	P00508.pdb.gz	AATM_CHICK Aspartate aminotransferase, mitochondrial OS=Gallus gallus OX=9031 GN=GOT2 PE=1 SV=2
3	PDB:3pd6A	0.930	0.997	1.976E-70	401	0.888	0.953	3pd6A.pdb.gz	Biochemical and structural characterization of mouse mitochondrial aspartate aminotransferase, a newly identified kynurenine aminotransferase-IV.
4	PDB:7aatA	0.925	0.992	7.062E-67	401	0.805	0.863	7aatA.pdb.gz	X-ray structure refinement and comparison of three forms of mitochondrial aspartate aminotransferase.
5	AFDB:Q8IPY3	0.944	0.942	3.298E-62	431	0.605	0.603	Q8IPY3.pdb.gz	Q8IPY3_DROME Aspartate aminotransferase OS=Drosophila melanogaster OX=7227 GN=Got2 PE=1 SV=1
6	AFDB:P46643	0.933	0.933	1.226E-56	430	0.542	0.542	P46643.pdb.gz	AAT1_ARATH Aspartate aminotransferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ASP1 PE=1 SV=1
7	AFDB:O94320	0.912	0.898	7.525E-55	437	0.526	0.517	O94320.pdb.gz	AATM_SCHPO Aspartate aminotransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC725.01 PE=3 SV=1
8	AFDB:P46644	0.921	0.882	5.132E-53	449	0.498	0.477	P46644.pdb.gz	AAT3_ARATH Aspartate aminotransferase 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ASP3 PE=1 SV=1
9	AFDB:P46645	0.916	0.973	2.250E-52	405	0.491	0.521	P46645.pdb.gz	AAT2_ARATH Aspartate aminotransferase, cytoplasmic isozyme 1 OS=Arabidopsis thaliana OX=3702 GN=ASP2 PE=1 SV=2
10	AFDB:P00504	0.921	0.961	4.468E-52	412	0.470	0.490	P00504.pdb.gz	AATC_CHICK Aspartate aminotransferase, cytoplasmic OS=Gallus gallus OX=9031 GN=GOT1 PE=1 SV=3
11	AFDB:B9DG21	0.931	0.868	7.575E-52	462	0.486	0.452	B9DG21.pdb.gz	B9DG21_ARATH Aspartate aminotransferase OS=Arabidopsis thaliana OX=3702 GN=ASP5 PE=1 SV=1
12	AFDB:Q5B082	0.917	0.886	2.419E-51	445	0.467	0.452	Q5B082.pdb.gz	Q5B082_EMENI Aspartate transaminase (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06048 PE=3 SV=1
13	PDB:2cstA	0.922	0.964	3.511E-49	411	0.470	0.491	2cstA.pdb.gz	Crystal structure of the closed form of chicken cytosolic aspartate aminotransferase at 1.9 A resolution.
14	PDB:6jpkA	0.898	0.944	1.489E-47	409	0.409	0.430	6jpkA.pdb.gz	Crystal structure of L-aspartate aminotransferase from Schizosaccharomyces pombe.
15	PDB:3wzfA	0.911	0.950	2.714E-46	412	0.456	0.476	3wzfA.pdb.gz
16	PDB:4eu1A	0.870	0.976	3.726E-46	383	0.421	0.473	4eu1A.pdb.gz
17	PDB:1yaaA	0.893	0.931	4.788E-44	412	0.416	0.434	1yaaA.pdb.gz	Crystal structure of Saccharomyces cerevisiae cytosolic aspartate aminotransferase.
18	PDB:3fslA	0.902	0.976	1.991E-43	397	0.374	0.406	3fslA.pdb.gz	Crystal structure of tyrosine aminotransferase tripple mutant (P181Q,R183G,A321K) from Escherichia coli at 2.35 A resolution
19	PDB:4f5fB	0.906	0.973	3.266E-42	400	0.372	0.400	4f5fB.pdb.gz
20	PDB:5yhvA	0.678	0.734	2.006E-16	394	0.181	0.198	5yhvA.pdb.gz	Crystal structure of an aminotransferase from Mycobacterium tuberculosis

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P00505	0.0	900	430	1.000	1.000	AATM_HUMAN Aspartate aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=GOT2 PE=1 SV=3
2	P00507	0.0	844	430	0.947	0.947	AATM_RAT Aspartate aminotransferase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Got2 PE=1 SV=2
3	P00508	0.0	744	423	0.798	0.811	AATM_CHICK Aspartate aminotransferase, mitochondrial OS=Gallus gallus OX=9031 GN=GOT2 PE=1 SV=2
4	P05202	0.0	846	430	0.947	0.947	AATM_MOUSE Aspartate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Got2 PE=1 SV=1
5	P12345	0.0	833	430	0.944	0.944	AATM_RABIT Aspartate aminotransferase, mitochondrial OS=Oryctolagus cuniculus OX=9986 GN=GOT2 PE=1 SV=2
6	Q8IPY3	0.0	566	431	0.605	0.603	Q8IPY3_DROME Aspartate aminotransferase OS=Drosophila melanogaster OX=7227 GN=Got2 PE=1 SV=1
7	Q8T0M9	0.0	551	393	0.591	0.646	Q8T0M9_DROME Aspartate aminotransferase OS=Drosophila melanogaster OX=7227 GN=Got2 PE=2 SV=1
8	Q9VQ61	0.0	563	424	0.607	0.616	Q9VQ61_DROME Aspartate aminotransferase OS=Drosophila melanogaster OX=7227 GN=Got2 PE=1 SV=1
9	P46643	2.09e-170	486	430	0.535	0.535	AAT1_ARATH Aspartate aminotransferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ASP1 PE=1 SV=1
10	O94320	1.64e-166	476	437	0.519	0.510	AATM_SCHPO Aspartate aminotransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC725.01 PE=3 SV=1
11	P46645	5.76e-154	443	405	0.493	0.523	AAT2_ARATH Aspartate aminotransferase, cytoplasmic isozyme 1 OS=Arabidopsis thaliana OX=3702 GN=ASP2 PE=1 SV=2
12	P46644	1.81e-153	444	449	0.500	0.479	AAT3_ARATH Aspartate aminotransferase 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ASP3 PE=1 SV=1
13	B9DG21	1.23e-146	427	462	0.491	0.457	B9DG21_ARATH Aspartate aminotransferase OS=Arabidopsis thaliana OX=3702 GN=ASP5 PE=1 SV=1
14	P00504	5.07e-145	421	412	0.477	0.498	AATC_CHICK Aspartate aminotransferase, cytoplasmic OS=Gallus gallus OX=9031 GN=GOT1 PE=1 SV=3
15	F4I0D4	8.48e-145	420	405	0.484	0.514	F4I0D4_ARATH Aspartate aminotransferase OS=Arabidopsis thaliana OX=3702 GN=ASP4 PE=1 SV=1
16	Q5B082	1.38e-140	411	445	0.465	0.449	Q5B082_EMENI Aspartate transaminase (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06048 PE=3 SV=1
17	P05201	9.57e-140	407	413	0.465	0.484	AATC_MOUSE Aspartate aminotransferase, cytoplasmic OS=Mus musculus OX=10090 GN=Got1 PE=1 SV=3
18	A0A140VK69	4.49e-139	406	413	0.463	0.482	A0A140VK69_HUMAN Aspartate aminotransferase OS=Homo sapiens OX=9606 PE=2 SV=1
19	P17174	4.49e-139	406	413	0.463	0.482	AATC_HUMAN Aspartate aminotransferase, cytoplasmic OS=Homo sapiens OX=9606 GN=GOT1 PE=1 SV=3
20	P13221	3.30e-138	404	413	0.460	0.479	AATC_RAT Aspartate aminotransferase, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Got1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00155 Aminotran_1_2	3e-93	324.5	Aminotransferase class I and II

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000245206

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000327070	0.996	Malate dehydrogenase, mitochondrial
2	9606.ENSP00000277865	0.978	Glutamate dehydrogenase 1, mitochondrial
3	9606.ENSP00000438144	0.978	Malate dehydrogenase, cytoplasmic
4	9606.ENSP00000355518	0.975	Fumarate hydratase, mitochondrial
5	9606.ENSP00000229270	0.971	Triosephosphate isomerase 1
6	9606.ENSP00000260508	0.971	Kynurenine--oxoglutarate transaminase 3
7	9606.ENSP00000345282	0.967	Alanine aminotransferase 2
8	9606.ENSP00000378408	0.963	Alanine aminotransferase 1
9	9606.ENSP00000331897	0.962	Isocitrate dehydrogenase [NADP], mitochondrial
10	9606.ENSP00000175506	0.961	Asparagine synthetase
11	9606.ENSP00000327589	0.961	Glutamate dehydrogenase 2, mitochondrial
12	9606.ENSP00000399415	0.958	Kynurenine--oxoglutarate transaminase 1
13	9606.ENSP00000390265	0.957	Isocitrate dehydrogenase 1, cytosolic
14	9606.ENSP00000216254	0.947	Aconitate hydratase, mitochondrial
15	9606.ENSP00000348234	0.943	Tyrosine aminotransferase
16	9606.ENSP00000377532	0.942	Pyruvate carboxylase, mitochondrial
17	9606.ENSP00000355493	0.940	Adenylosuccinate synthetase isozyme 2
18	9606.ENSP00000359976	0.937	Cystathionine gamma-lyase
19	9606.ENSP00000361471	0.937	Argininosuccinate synthase
20	9606.ENSP00000364490	0.936	Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004069	1.000	L-aspartate:2-oxoglutarate aminotransferase activity
GO:0005488	0.995	binding
GO:0005515	0.943	protein binding
GO:0042802	0.547	identical protein binding
GO:0097159	0.367	organic cyclic compound binding
GO:1901363	0.354	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0071704	0.993	organic substance metabolic process
GO:0044238	0.992	primary metabolic process
GO:0044237	0.992	cellular metabolic process
GO:0044281	0.976	small molecule metabolic process
GO:0006807	0.975	nitrogen compound metabolic process
GO:0043648	0.953	dicarboxylic acid metabolic process
GO:1901564	0.940	organonitrogen compound metabolic process
GO:0009066	0.930	aspartate family amino acid metabolic process
GO:0009064	0.834	glutamine family amino acid metabolic process
GO:0046395	0.829	carboxylic acid catabolic process
GO:0006536	0.803	glutamate metabolic process
GO:0009058	0.542	biosynthetic process
GO:1901576	0.393	organic substance biosynthetic process
GO:0044249	0.334	cellular biosynthetic process
GO:0065007	0.322	biological regulation
GO:0050896	0.300	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.983	intracellular organelle lumen
GO:0005759	0.969	mitochondrial matrix
GO:0016020	0.955	membrane
GO:0005576	0.907	extracellular region
GO:0005615	0.518	extracellular space
GO:0031982	0.476	vesicle
GO:0005829	0.400	cytosol
GO:0031090	0.380	organelle membrane
GO:0005886	0.307	plasma membrane
GO:1903561	0.305	extracellular vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21824	1.000	2-oxoglutarate + L-aspartate = L-glutamate + oxaloacetate
EC:2.6.1.1	1.000	aspartate transaminase.

[back to server]