StarFunc result for job id P00519

User Input

>input (1130 residues)
MLEICLKLVGCKSKKGLSSSSSCYLEEALQRPVASDFEPQGLSEAARWNSKENLLAGPSE
NDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVN
SLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTAS
DGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTVYGVSPNYDKWEMERT
DITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQ
LLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFI
HRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKS
DVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNP
SDRPSFAEIHQAFETMFQESSISDEVEKELGKQGVRGAVSTLLQAPELPTKTRTSRRAAE
HRDTTDVPEMPHSKGQGESDPLDHEPAVSPLLPRKERGPPEGGLNEDERLLPKDKKTNLF
SALIKKKKKTAPTPPKRSSSFREMDGQPERRGAGEEEGRDISNGALAFTPLDTADPAKSP
KPSNGAGVPNGALRESGGSGFRSPHLWKKSSTLTSSRLATGEEEGGGSSSKRFLRSCSAS
CVPHGAKDTEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRAGENRSDQVTRGTV
TPPPRLVKKNEEAADEVFKDIMESSPGSSPPNLTPKPLRRQVTVAPASGLPHKEEAGKGS
ALGTPAAAEPVTPTSKAGSGAPGGTSKGPAEESRVRRHKHSSESPGRDKGKLSRLKPAPP
PPPAASAGKAGGKPSQSPSQEAAGEAVLGAKTKATSLVDAVNSDAAKPSQPGEGLKKPVL
PATPKPQSAKPSGTPISPAPVPSTLPSASSALAGDQPSSTAFIPLISTRVSLRKTRQPPE
RIASGAITKGVVLDSTEALCLAISRNSEQMASHSAVLEAGKNLYTFCVSYVDSIQQMRNK
FAFREAINKLENNLRELQICPATAGSGPAATQDFSKLLSSVKEISDIVQR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R8E2	0.434	0.434	0.000	1130	1.000	1.000	A0A024R8E2.pdb.gz
2	AFDB:E9PT20	0.474	0.469	0.000	1143	0.856	0.846	E9PT20.pdb.gz	E9PT20_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Abl1 PE=3 SV=1
3	AFDB:F7BN18	0.428	0.429	0.000	1128	0.734	0.735	F7BN18.pdb.gz	F7BN18_XENTR Tyrosine-protein kinase OS=Xenopus tropicalis OX=8364 GN=abl1 PE=3 SV=4
4	AFDB:P42684	0.420	0.403	1.864E-99	1182	0.544	0.520	P42684.pdb.gz	ABL2_HUMAN Tyrosine-protein kinase ABL2 OS=Homo sapiens OX=9606 GN=ABL2 PE=1 SV=1
5	PDB:2h8hA	0.349	0.833	2.232E-44	445	0.170	0.431	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
6	PDB:1k9aB	0.233	0.575	2.203E-41	441	0.154	0.395	1k9aB.pdb.gz
7	PDB:4fl2A	0.225	0.434	5.496E-32	555	0.135	0.274	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
8	PDB:4k2rA	0.230	0.451	3.470E-28	551	0.120	0.247	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
9	AFDB:P09208	0.222	0.120	6.633E-27	2144	0.181	0.095	P09208.pdb.gz	INSR_DROME Insulin-like receptor OS=Drosophila melanogaster OX=7227 GN=InR PE=1 SV=3
10	AFDB:A0A0G2JUN9	0.220	0.231	3.358E-25	1077	0.208	0.218	A0A0G2JUN9.pdb.gz	A0A0G2JUN9_RAT Mitogen-activated protein kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map3k9 PE=3 SV=2
11	AFDB:Q5TCX8	0.219	0.238	6.345E-25	1036	0.188	0.206	Q5TCX8.pdb.gz	M3K21_HUMAN Mitogen-activated protein kinase kinase kinase 21 OS=Homo sapiens OX=9606 GN=MAP3K21 PE=1 SV=3
12	AFDB:P80192	0.216	0.221	1.482E-24	1104	0.202	0.207	P80192.pdb.gz	M3K9_HUMAN Mitogen-activated protein kinase kinase kinase 9 OS=Homo sapiens OX=9606 GN=MAP3K9 PE=1 SV=3
13	AFDB:Q95UN8	0.201	0.196	6.750E-23	1161	0.178	0.173	Q95UN8.pdb.gz	M3KSL_DROME Mitogen-activated protein kinase kinase kinase OS=Drosophila melanogaster OX=7227 GN=slpr PE=1 SV=1
14	AFDB:A0A0K3AV08	0.223	0.237	2.826E-22	1059	0.181	0.193	A0A0K3AV08.pdb.gz	MLK1_CAEEL Mitogen-activated protein kinase kinase kinase mlk-1 OS=Caenorhabditis elegans OX=6239 GN=mlk-1 PE=1 SV=1
15	PDB:5u6yA	0.210	0.488	2.320E-17	459	0.065	0.159	5u6yA.pdb.gz
16	PDB:1unlA	0.207	0.753	4.384E-17	292	0.058	0.223	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
17	PDB:8dksA	0.195	0.713	8.285E-17	283	0.060	0.240	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
18	PDB:4krcA	0.202	0.713	1.408E-16	297	0.058	0.222	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
19	PDB:4yc3A	0.186	0.660	1.651E-16	295	0.063	0.241	4yc3A.pdb.gz
20	PDB:7myjC	0.208	0.485	2.661E-16	465	0.064	0.155	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PT20	0.0	1915	1143	0.856	0.846	E9PT20_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Abl1 PE=3 SV=1
2	F7BN18	0.0	1497	1128	0.732	0.733	F7BN18_XENTR Tyrosine-protein kinase OS=Xenopus tropicalis OX=8364 GN=abl1 PE=3 SV=4
3	P00519	0.0	2323	1130	1.000	1.000	ABL1_HUMAN Tyrosine-protein kinase ABL1 OS=Homo sapiens OX=9606 GN=ABL1 PE=1 SV=4
4	P00520	0.0	1920	1123	0.881	0.887	ABL1_MOUSE Tyrosine-protein kinase ABL1 OS=Mus musculus OX=10090 GN=Abl1 PE=1 SV=3
5	P00522	0.0	781	1620	0.313	0.219	ABL_DROME Tyrosine-protein kinase Abl OS=Drosophila melanogaster OX=7227 GN=Abl PE=1 SV=3
6	P03949	0.0	618	1224	0.263	0.243	ABL1_CAEEL Tyrosine-protein kinase abl-1 OS=Caenorhabditis elegans OX=6239 GN=abl-1 PE=1 SV=4
7	P42684	0.0	991	1182	0.451	0.431	ABL2_HUMAN Tyrosine-protein kinase ABL2 OS=Homo sapiens OX=9606 GN=ABL2 PE=1 SV=1
8	Q2PYT4	0.0	1913	1143	0.855	0.845	Q2PYT4_RAT Tyrosine-protein kinase (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=1
9	Q4JIM5	0.0	964	1182	0.419	0.401	ABL2_MOUSE Tyrosine-protein kinase ABL2 OS=Mus musculus OX=10090 GN=Abl2 PE=1 SV=1
10	Q9V9J3	5.85e-127	400	517	0.176	0.385	SRC42_DROME Tyrosine-protein kinase Src42A OS=Drosophila melanogaster OX=7227 GN=Src42A PE=1 SV=1
11	Q62662	6.59e-124	392	506	0.179	0.399	FRK_RAT Tyrosine-protein kinase FRK OS=Rattus norvegicus OX=10116 GN=Frk PE=1 SV=3
12	P42685	1.70e-121	385	505	0.174	0.390	FRK_HUMAN Tyrosine-protein kinase FRK OS=Homo sapiens OX=9606 GN=FRK PE=1 SV=1
13	A1A5H8	1.82e-119	381	546	0.175	0.363	YES_DANRE Tyrosine-protein kinase yes OS=Danio rerio OX=7955 GN=yes1 PE=1 SV=1
14	Q6EWH2	2.94e-119	380	537	0.173	0.365	FYNA_DANRE Tyrosine-protein kinase fyna OS=Danio rerio OX=7955 GN=fyna PE=1 SV=2
15	P09324	6.61e-119	380	541	0.175	0.366	YES_CHICK Tyrosine-protein kinase Yes OS=Gallus gallus OX=9031 GN=YES1 PE=1 SV=3
16	P07947	7.40e-119	379	543	0.175	0.365	YES_HUMAN Tyrosine-protein kinase Yes OS=Homo sapiens OX=9606 GN=YES1 PE=1 SV=3
17	J3QRU1	7.84e-119	380	548	0.175	0.361	J3QRU1_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=YES1 PE=1 SV=1
18	Q04736	1.26e-118	379	541	0.175	0.366	YES_MOUSE Tyrosine-protein kinase Yes OS=Mus musculus OX=10090 GN=Yes1 PE=1 SV=3
19	F1LM93	3.70e-118	377	541	0.175	0.366	YES_RAT Tyrosine-protein kinase Yes OS=Rattus norvegicus OX=10116 GN=Yes1 PE=1 SV=1
20	F1NQU9	1.87e-117	375	534	0.173	0.367	F1NQU9_CHICK Tyrosine-protein kinase OS=Gallus gallus OX=9031 GN=FYN PE=3 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	8.9e+02	10.3	ABC1 atypical kinase-like domain
2	PF08919 F_actin_bind	3.4e-27	106.1	F-actin binding
3	PF12330 Haspin_kinase	23	15.4	Haspin like kinase domain
4	PF14531 Kinase-like	1.4e+02	13.3	Kinase-like
5	PF00069 Pkinase	1.4e-44	164.1	Protein kinase domain
6	PF07714 PK_Tyr_Ser-Thr	7.7e-96	331.9	Protein tyrosine and serine/threonine kinase
7	PF00017 SH2	3.5e-20	83.2	SH2 domain
8	PF00018 SH3_1	4.6e-09	47.1	SH3 domain
9	PF07653 SH3_2	0.00035	31.6	Variant SH3 domain
10	PF08239 SH3_3	1.1	21.0	Bacterial SH3 domain
11	PF12913 SH3_6	2.5e+02	12.6	SH3 domain (SH3b1 type)
12	PF14604 SH3_9	0.00069	30.8	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000010882

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000010203	0.991	CRK proto-oncogene, adaptor protein
2	60711.ENSCSAP00000001067	0.988	Growth factor receptor-bound protein 2
3	60711.ENSCSAP00000015538	0.988	Cbl proto-oncogene, E3 ubiquitin protein ligase
4	60711.ENSCSAP00000009368	0.985	CRK like proto-oncogene, adaptor protein
5	60711.ENSCSAP00000013762	0.980	RB transcriptional corepressor 1
6	60711.ENSCSAP00000010240	0.978	BCR, RhoGEF and GTPase activating protein
7	60711.ENSCSAP00000008178	0.977	Abl-interactor 1
8	60711.ENSCSAP00000003814	0.974	Plays an important role in homologous strand exchange, a key step in DNA repair through homologous recombination. Binds to single and double-stranded DNA and exhibits DNA-dependent ATPase activity. Catalyzes the recognition of homology and strand exchange between homologous DNA partners to form a joint molecule between a processed DNA break and the repair template. Binds to single-stranded DNA in an ATP-dependent manner to form nucleoprotein filaments which are essential for the homology search and strand exchange.
9	60711.ENSCSAP00000006558	0.972	Abl-interactor 2
10	60711.ENSCSAP00000015071	0.972	Serine/threonine protein kinase which activates checkpoint signaling upon double strand breaks (DSBs), apoptosis and genotoxic stresses such as ionizing ultraviolet A light (UVA), thereby acting as a DNA damage sensor. Recognizes the substrate consensus sequence [ST]- Q. Phosphorylates 'Ser-139' of histone variant H2AX/H2AFX at double strand breaks (DSBs), thereby regulating DNA damage response mechanism. Also plays a role in pre-B cell allelic exclusion, a process leading to expression of a single immunoglobulin heavy chain allele to enforce clonality and monospecific recognition by t [...]
11	60711.ENSCSAP00000004417	0.967	Ras and Rab interactor 1
12	60711.ENSCSAP00000002173	0.951	Uncharacterized protein
13	60711.ENSCSAP00000015828	0.951	Neurotrophic tyrosine kinase, receptor, type 1
14	60711.ENSCSAP00000002171	0.939	Roundabout, axon guidance receptor, homolog 2 (Drosophila)
15	60711.ENSCSAP00000003745	0.938	Uncharacterized protein
16	60711.ENSCSAP00000008280	0.938	Tyrosine-protein kinase
17	60711.ENSCSAP00000011831	0.934	Docking protein 1, 62kDa (downstream of tyrosine kinase 1)
18	60711.ENSCSAP00000015866	0.927	Ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3)
19	60711.ENSCSAP00000017283	0.927	Tumor protein p73
20	60711.ENSCSAP00000003785	0.926	Ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004713	0.998	protein tyrosine kinase activity
GO:0043167	0.985	ion binding
GO:0046872	0.982	metal ion binding
GO:0019900	0.945	kinase binding
GO:0019901	0.942	protein kinase binding
GO:0019904	0.891	protein domain specific binding
GO:0000287	0.821	magnesium ion binding
GO:0046914	0.789	transition metal ion binding
GO:0030145	0.726	manganese ion binding
GO:0003779	0.612	actin binding
GO:0044877	0.573	protein-containing complex binding
GO:0004715	0.384	non-membrane spanning protein tyrosine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0050794	0.992	regulation of cellular process
GO:0009987	0.990	cellular process
GO:0050896	0.981	response to stimulus
GO:0048522	0.978	positive regulation of cellular process
GO:0071704	0.956	organic substance metabolic process
GO:0044237	0.955	cellular metabolic process
GO:0044238	0.951	primary metabolic process
GO:0048583	0.946	regulation of response to stimulus
GO:0043412	0.946	macromolecule modification
GO:0065009	0.941	regulation of molecular function
GO:0051716	0.940	cellular response to stimulus
GO:0036211	0.925	protein modification process
GO:0051128	0.907	regulation of cellular component organization
GO:0044087	0.891	regulation of cellular component biogenesis
GO:0016310	0.876	phosphorylation
GO:0032501	0.839	multicellular organismal process
GO:0042221	0.813	response to chemical
GO:0023052	0.806	signaling
GO:0007165	0.798	signal transduction
GO:0032970	0.786	regulation of actin filament-based process
GO:0071840	0.734	cellular component organization or biogenesis
GO:0033043	0.731	regulation of organelle organization
GO:0048856	0.723	anatomical structure development
GO:0016043	0.715	cellular component organization
GO:0018212	0.711	peptidyl-tyrosine modification
GO:0006468	0.696	protein phosphorylation
GO:0051493	0.692	regulation of cytoskeleton organization
GO:0007275	0.684	multicellular organism development
GO:0048584	0.670	positive regulation of response to stimulus
GO:0010941	0.608	regulation of cell death
GO:0023051	0.585	regulation of signaling
GO:0010646	0.584	regulation of cell communication
GO:0043393	0.578	regulation of protein binding
GO:0051239	0.573	regulation of multicellular organismal process
GO:0060255	0.526	regulation of macromolecule metabolic process
GO:0048519	0.518	negative regulation of biological process
GO:0048731	0.510	system development
GO:0018108	0.508	peptidyl-tyrosine phosphorylation
GO:0007169	0.507	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0051130	0.491	positive regulation of cellular component organization
GO:0048523	0.489	negative regulation of cellular process
GO:0009966	0.479	regulation of signal transduction
GO:0070887	0.474	cellular response to chemical stimulus
GO:0010033	0.469	response to organic substance
GO:0048869	0.449	cellular developmental process
GO:0065008	0.442	regulation of biological quality
GO:0030154	0.441	cell differentiation
GO:0035556	0.434	intracellular signal transduction
GO:0051171	0.431	regulation of nitrogen compound metabolic process
GO:0031323	0.431	regulation of cellular metabolic process
GO:0080090	0.430	regulation of primary metabolic process
GO:0050790	0.423	regulation of catalytic activity
GO:1902531	0.396	regulation of intracellular signal transduction
GO:2000145	0.383	regulation of cell motility
GO:0050793	0.381	regulation of developmental process
GO:0032956	0.358	regulation of actin cytoskeleton organization
GO:0043067	0.355	regulation of programmed cell death
GO:0030334	0.350	regulation of cell migration
GO:0043085	0.341	positive regulation of catalytic activity
GO:0045785	0.339	positive regulation of cell adhesion
GO:0009893	0.331	positive regulation of metabolic process
GO:0032879	0.318	regulation of localization
GO:0030335	0.318	positive regulation of cell migration
GO:1901700	0.317	response to oxygen-containing compound
GO:0031325	0.309	positive regulation of cellular metabolic process
GO:0008219	0.307	cell death
GO:0006996	0.305	organelle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0005634	0.992	nucleus
GO:0043232	0.984	intracellular non-membrane-bounded organelle
GO:0030054	0.971	cell junction
GO:0005829	0.970	cytosol
GO:0031981	0.961	nuclear lumen
GO:0005654	0.954	nucleoplasm
GO:0005856	0.953	cytoskeleton
GO:0015629	0.845	actin cytoskeleton
GO:0071944	0.768	cell periphery
GO:0005886	0.760	plasma membrane
GO:0045202	0.651	synapse
GO:0016604	0.615	nuclear body
GO:0120025	0.480	plasma membrane bounded cell projection
GO:0031252	0.380	cell leading edge
GO:0032991	0.361	protein-containing complex
GO:0036477	0.335	somatodendritic compartment

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10596	0.998	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]
EC:2.7.10.2	0.384	non-specific protein-tyrosine kinase.

[back to server]