StarFunc result for job id P00540

User Input

>input (346 residues)
MPSPLALRPYLRSEFSPSVDARPCSSPSELPAKLLLGATLPRAPRLPRRLAWCSIDWEQV
CLLQRLGAGGFGSVYKATYRGVPVAIKQVNKCTKNRLASRRSFWAELNVARLRHDNIVRV
VAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAGHPEGDAGEPHCRTGGQLSLGKCLK
YSLDVVNGLLFLHSQSIVHLDLKPANILISEQDVCKISDFGCSEKLEDLLCFQTPSYPLG
GTYTHRAPELLKGEGVTPKADIYSFAITLWQMTTKQAPYSGERQHILYAVVAYDLRPSLS
AAVFEDSLPGQRLGDVIQRCWRPSAAQRPSARLLLVDLTSLKAELG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P00540	1.000	1.000	2.331E-63	346	1.000	1.000	P00540.pdb.gz	MOS_HUMAN Proto-oncogene serine/threonine-protein kinase mos OS=Homo sapiens OX=9606 GN=MOS PE=1 SV=1
2	AFDB:P50118	0.829	0.831	1.906E-51	345	0.798	0.800	P50118.pdb.gz	MOS_PIG Proto-oncogene serine/threonine-protein kinase mos OS=Sus scrofa OX=9823 GN=MOS PE=2 SV=1
3	AFDB:P00536	0.814	0.821	1.861E-48	343	0.740	0.746	P00536.pdb.gz	MOS_MOUSE Proto-oncogene serine/threonine-protein kinase mos OS=Mus musculus OX=10090 GN=Mos PE=2 SV=3
4	AFDB:P12965	0.762	0.736	3.738E-38	359	0.535	0.515	P12965.pdb.gz	MOS_XENLA Serine/threonine-protein kinase mos OS=Xenopus laevis OX=8355 GN=mos PE=2 SV=1
5	AFDB:Q9GRC0	0.708	0.698	2.826E-25	351	0.335	0.330	Q9GRC0.pdb.gz	MOS_PATPE Serine/threonine-protein kinase mos OS=Patiria pectinifera OX=7594 GN=mos PE=1 SV=1
6	AFDB:Q2MHE4	0.720	0.643	1.502E-21	390	0.275	0.244	Q2MHE4.pdb.gz	HT1_ARATH Serine/threonine/tyrosine-protein kinase HT1 OS=Arabidopsis thaliana OX=3702 GN=HT1 PE=1 SV=1
7	AFDB:A0A384KC16	0.699	0.624	3.896E-21	391	0.266	0.235	A0A384KC16.pdb.gz	A0A384KC16_ARATH ATMRK1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g57540 PE=1 SV=1
8	AFDB:Q940A2	0.673	0.364	5.353E-21	658	0.231	0.122	Q940A2.pdb.gz	P2C31_ARATH Protein kinase and PP2C-like domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=At2g40860/At2g40870 PE=2 SV=1
9	AFDB:A0A178UNT9	0.698	0.470	7.755E-21	525	0.240	0.158	A0A178UNT9.pdb.gz	A0A178UNT9_ARATH (thale cress) hypothetical protein OS=Arabidopsis thaliana OX=3702 GN=At5g58950 PE=1 SV=1
10	AFDB:Q05609	0.706	0.309	1.908E-20	821	0.266	0.112	Q05609.pdb.gz	CTR1_ARATH Serine/threonine-protein kinase CTR1 OS=Arabidopsis thaliana OX=3702 GN=CTR1 PE=1 SV=1
11	PDB:8dksA	0.594	0.716	2.749E-17	283	0.208	0.254	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
12	PDB:1k9aB	0.654	0.520	2.541E-16	441	0.225	0.177	1k9aB.pdb.gz
13	PDB:2qkwB	0.622	0.728	8.147E-16	292	0.208	0.247	2qkwB.pdb.gz
14	PDB:2h8hA	0.637	0.503	1.007E-15	445	0.237	0.184	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
15	PDB:4eomC	0.607	0.745	1.459E-15	276	0.188	0.236	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
16	PDB:4krcA	0.639	0.736	1.803E-15	297	0.220	0.256	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
17	PDB:5u6yA	0.610	0.468	3.784E-15	459	0.171	0.129	5u6yA.pdb.gz
18	PDB:6s73A	0.644	0.814	8.828E-15	269	0.199	0.257	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
19	PDB:1unlA	0.606	0.709	2.684E-14	292	0.176	0.209	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
20	PDB:2bujA	0.583	0.685	3.688E-14	291	0.199	0.237	2bujA.pdb.gz	Crystal Structure of the Human Serine-Threonine Kinase 16 in Complex with Staurosporine

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P00540	0.0	709	346	1.000	1.000	MOS_HUMAN Proto-oncogene serine/threonine-protein kinase mos OS=Homo sapiens OX=9606 GN=MOS PE=1 SV=1
2	P50118	0.0	520	345	0.798	0.800	MOS_PIG Proto-oncogene serine/threonine-protein kinase mos OS=Sus scrofa OX=9823 GN=MOS PE=2 SV=1
3	P00536	3.92e-179	501	343	0.737	0.743	MOS_MOUSE Proto-oncogene serine/threonine-protein kinase mos OS=Mus musculus OX=10090 GN=Mos PE=2 SV=3
4	P00539	6.82e-169	475	339	0.717	0.732	MOS_RAT Proto-oncogene serine/threonine-protein kinase mos OS=Rattus norvegicus OX=10116 GN=Mos PE=2 SV=2
5	P12965	1.05e-115	341	359	0.540	0.521	MOS_XENLA Serine/threonine-protein kinase mos OS=Xenopus laevis OX=8355 GN=mos PE=2 SV=1
6	Q9GRC0	9.50e-63	205	351	0.344	0.339	MOS_PATPE Serine/threonine-protein kinase mos OS=Patiria pectinifera OX=7594 GN=mos PE=1 SV=1
7	Q8RWL6	6.14e-31	125	570	0.249	0.151	STY17_ARATH Serine/threonine-protein kinase STY17 OS=Arabidopsis thaliana OX=3702 GN=STY17 PE=1 SV=1
8	Q2MHE4	1.13e-30	122	390	0.289	0.256	HT1_ARATH Serine/threonine/tyrosine-protein kinase HT1 OS=Arabidopsis thaliana OX=3702 GN=HT1 PE=1 SV=1
9	Q9C9U5	6.69e-30	122	1030	0.257	0.086	SIS8_ARATH Probable serine/threonine-protein kinase SIS8 OS=Arabidopsis thaliana OX=3702 GN=SIS8 PE=1 SV=1
10	Q12852	2.56e-29	121	859	0.237	0.095	M3K12_HUMAN Mitogen-activated protein kinase kinase kinase 12 OS=Homo sapiens OX=9606 GN=MAP3K12 PE=1 SV=2
11	Q60700	3.08e-29	120	888	0.237	0.092	M3K12_MOUSE Mitogen-activated protein kinase kinase kinase 12 OS=Mus musculus OX=10090 GN=Map3k12 PE=1 SV=1
12	O43283	1.13e-28	119	966	0.246	0.088	M3K13_HUMAN Mitogen-activated protein kinase kinase kinase 13 OS=Homo sapiens OX=9606 GN=MAP3K13 PE=1 SV=1
13	Q1HKZ5	1.83e-28	118	959	0.246	0.089	M3K13_MOUSE Mitogen-activated protein kinase kinase kinase 13 OS=Mus musculus OX=10090 GN=Map3k13 PE=1 SV=1
14	Q1EC11	4.71e-28	114	364	0.223	0.212	Q1EC11_DROME IP11267p OS=Drosophila melanogaster OX=7227 GN=Mos PE=2 SV=1
15	Q9LVQ9	5.00e-28	115	405	0.234	0.200	Q9LVQ9_ARATH Protein kinase ATN1-like protein OS=Arabidopsis thaliana OX=3702 GN=MSN2.10 PE=1 SV=1
16	Q9M085	7.91e-28	114	412	0.243	0.204	Q9M085_ARATH AT4G31170 protein OS=Arabidopsis thaliana OX=3702 GN=RAF28 PE=1 SV=1
17	Q9STG5	9.40e-28	115	475	0.260	0.189	Q9STG5_ARATH Protein kinase 6-like protein OS=Arabidopsis thaliana OX=3702 GN=T6H20.40 PE=4 SV=1
18	Q54TA1	1.30e-27	115	749	0.249	0.115	DRKC_DICDI Probable serine/threonine-protein kinase drkC OS=Dictyostelium discoideum OX=44689 GN=drkC PE=3 SV=1
19	Q8S9K4	1.36e-27	115	880	0.251	0.099	Q8S9K4_ARATH AT5g11850/F14F18_20 OS=Arabidopsis thaliana OX=3702 GN=MKD1 PE=1 SV=1
20	O22558	2.88e-27	114	546	0.234	0.148	STY8_ARATH Serine/threonine-protein kinase STY8 OS=Arabidopsis thaliana OX=3702 GN=STY8 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	42	14.7	ABC1 atypical kinase-like domain
2	PF00069 Pkinase	2.2e-37	140.5	Protein kinase domain
3	PF07714 PK_Tyr_Ser-Thr	1e-33	128.3	Protein tyrosine and serine/threonine kinase
4	PF19974 TCAD9	5.7e+02	10.9	Ternary complex associated domain 9

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000310722

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000335153	0.870	Heat shock protein HSP 90-alpha
2	9606.ENSP00000262948	0.866	Dual specificity mitogen-activated protein kinase kinase 2
3	9606.ENSP00000360609	0.866	Heat shock protein HSP 90-beta
4	9606.ENSP00000302486	0.852	Dual specificity mitogen-activated protein kinase kinase 1
5	9606.ENSP00000252677	0.847	Bone morphogenetic protein 15
6	9606.ENSP00000262300	0.845	Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase
7	9606.ENSP00000478672	0.729	V(D)J recombination-activating protein 2
8	9606.ENSP00000354554	0.728	Cytochrome b
9	9606.ENSP00000354961	0.725	NADH-ubiquinone oxidoreductase chain 4
10	9606.ENSP00000477715	0.701	Cytoplasmic polyadenylation element-binding protein 1
11	9606.ENSP00000261461	0.694	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform
12	9606.ENSP00000451605	0.685	Melanocyte-stimulating hormone receptor
13	9606.ENSP00000256078	0.667	GTPase KRas
14	9606.ENSP00000407586	0.667	GTPase HRas
15	9606.ENSP00000319799	0.661	Histone H1oo
16	9606.ENSP00000367942	0.661	Growth/differentiation factor 9
17	9606.ENSP00000256196	0.657	Ras-related protein R-Ras2
18	9606.ENSP00000257552	0.651	RNA-binding protein Musashi homolog 1
19	9606.ENSP00000358548	0.650	GTPase NRas
20	9606.ENSP00000246792	0.642	Ras-related protein R-Ras

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004672	1.000	protein kinase activity
GO:0004674	0.889	protein serine/threonine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.997	regulation of cellular process
GO:0051716	0.966	cellular response to stimulus
GO:0007154	0.918	cell communication
GO:0023052	0.908	signaling
GO:0007165	0.897	signal transduction
GO:0048519	0.786	negative regulation of biological process
GO:0051726	0.748	regulation of cell cycle
GO:0035556	0.733	intracellular signal transduction
GO:0044237	0.720	cellular metabolic process
GO:0048523	0.681	negative regulation of cellular process
GO:0051983	0.671	regulation of chromosome segregation
GO:0044238	0.655	primary metabolic process
GO:0071704	0.651	organic substance metabolic process
GO:0006807	0.616	nitrogen compound metabolic process
GO:0043170	0.573	macromolecule metabolic process
GO:1901564	0.550	organonitrogen compound metabolic process
GO:0048518	0.541	positive regulation of biological process
GO:0019538	0.511	protein metabolic process
GO:0043412	0.506	macromolecule modification
GO:0051128	0.486	regulation of cellular component organization
GO:0033045	0.480	regulation of sister chromatid segregation
GO:0006468	0.470	protein phosphorylation
GO:1905818	0.455	regulation of chromosome separation
GO:0048522	0.451	positive regulation of cellular process
GO:0010948	0.422	negative regulation of cell cycle process
GO:0000165	0.337	MAPK cascade
GO:1902099	0.331	regulation of metaphase/anaphase transition of cell cycle
GO:1902100	0.312	negative regulation of metaphase/anaphase transition of cell cycle
GO:0048583	0.311	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.995	cytosol
GO:0043226	0.681	organelle
GO:0043227	0.670	membrane-bounded organelle
GO:0043231	0.432	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]