StarFunc result for job id P00568

User Input

>input (194 residues)
MEEKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEI
MEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDA
GPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVD
SVFSQVCTHLDALK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P39069	0.999	0.999	3.093E-34	194	0.902	0.902	P39069.pdb.gz	KAD1_RAT Adenylate kinase isoenzyme 1 OS=Rattus norvegicus OX=10116 GN=Ak1 PE=1 SV=3
2	AFDB:Q5T9B7	0.993	0.917	1.100E-33	210	0.990	0.914	Q5T9B7.pdb.gz	Q5T9B7_HUMAN Adenylate kinase isoenzyme 1 OS=Homo sapiens OX=9606 GN=AK1 PE=1 SV=1
3	AFDB:P05081	0.982	0.982	8.130E-32	194	0.825	0.825	P05081.pdb.gz	KAD1_CHICK Adenylate kinase isoenzyme 1 OS=Gallus gallus OX=9031 GN=AK1 PE=1 SV=1
4	PDB:2c95A	0.976	0.971	5.574E-31	195	0.979	0.974	2c95A.pdb.gz	Structure of Adenylate Kinase 1 in Complex with P1, P4-Di(Adenosine)Tetraphosphate
5	AFDB:Q8IQG9	0.938	0.798	2.946E-22	229	0.469	0.397	Q8IQG9.pdb.gz	Q8IQG9_DROME Adenylate kinase 1, isoform B OS=Drosophila melanogaster OX=7227 GN=Ak1 PE=1 SV=1
6	AFDB:Q9Y6K8	0.869	0.316	6.378E-22	562	0.577	0.199	Q9Y6K8.pdb.gz	KAD5_HUMAN Adenylate kinase isoenzyme 5 OS=Homo sapiens OX=9606 GN=AK5 PE=1 SV=2
7	AFDB:P15700	0.931	0.886	1.187E-20	204	0.423	0.402	P15700.pdb.gz	KCY_YEAST Uridylate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=URA6 PE=1 SV=1
8	AFDB:O04905	0.896	0.861	7.744E-20	202	0.433	0.416	O04905.pdb.gz	KCY3_ARATH UMP-CMP kinase 3 OS=Arabidopsis thaliana OX=3702 GN=UMK3 PE=1 SV=1
9	AFDB:P30085	0.896	0.888	1.586E-19	196	0.402	0.398	P30085.pdb.gz	KCY_HUMAN UMP-CMP kinase OS=Homo sapiens OX=9606 GN=CMPK1 PE=1 SV=3
10	PDB:1ukyA	0.928	0.918	2.196E-19	196	0.423	0.418	1ukyA.pdb.gz	Substrate specificity and assembly of the catalytic center derived from two structures of ligated uridylate kinase.
11	AFDB:Q8VY84	0.923	0.879	2.209E-19	204	0.397	0.377	Q8VY84.pdb.gz	KCY1_ARATH Probable UMP-CMP kinase 1 OS=Arabidopsis thaliana OX=3702 GN=UMK1 PE=2 SV=1
12	AFDB:P20425	0.914	0.909	2.754E-19	195	0.407	0.405	P20425.pdb.gz	KCY_DICDI UMP-CMP kinase OS=Dictyostelium discoideum OX=44689 GN=pyrK PE=1 SV=2
13	PDB:1qf9A	0.910	0.910	2.108E-18	194	0.407	0.407	1qf9A.pdb.gz	pH influences fluoride coordination number of the AlFx phosphoryl transfer transition state analog.
14	PDB:1tevA	0.748	0.748	2.560E-16	194	0.397	0.397	1tevA.pdb.gz
15	PDB:2cdnA	0.835	0.869	3.821E-15	186	0.304	0.317	2cdnA.pdb.gz	The Crystal Structure of Mycobacterium Tuberculosis Adenylate Kinase in Complex with Two Molecules of Adp and Mg2+ Supports an Associative Mechanism for Phosphoryl Transfer.
16	PDB:1akeA	0.830	0.756	6.027E-14	214	0.351	0.318	1akeA.pdb.gz	Structure of the complex between adenylate kinase from Escherichia coli and the inhibitor Ap5A refined at 1.9 A resolution. A model for a catalytic transition state.
17	PDB:3tlxB	0.846	0.690	6.368E-14	240	0.314	0.254	3tlxB.pdb.gz	Crystal Structure of PF10_0086, adenylate kinase from plasmodium falciparum
18	PDB:1dvrA	0.705	0.631	1.843E-12	220	0.278	0.245	1dvrA.pdb.gz	Structure of a mutant adenylate kinase ligated with an ATP-analogue showing domain closure over ATP.
19	PDB:6zjbD	0.827	0.741	1.947E-12	218	0.289	0.257	6zjbD.pdb.gz	Structural Basis for GTP versus ATP Selectivity in the NMP Kinase AK3.
20	PDB:2c9yA	0.688	0.624	3.199E-12	218	0.335	0.298	2c9yA.pdb.gz	Structure of Human Adenylate Kinase 2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P00568	2.13e-141	393	194	1.000	1.000	KAD1_HUMAN Adenylate kinase isoenzyme 1 OS=Homo sapiens OX=9606 GN=AK1 PE=1 SV=3
2	Q6FGX9	2.13e-141	393	194	1.000	1.000	Q6FGX9_HUMAN Adenylate kinase isoenzyme 1 OS=Homo sapiens OX=9606 GN=AK1 PE=2 SV=1
3	Q5T9B7	2.52e-139	389	210	0.990	0.914	Q5T9B7_HUMAN Adenylate kinase isoenzyme 1 OS=Homo sapiens OX=9606 GN=AK1 PE=1 SV=1
4	P00571	3.76e-135	377	194	0.954	0.954	KAD1_PIG Adenylate kinase isoenzyme 1 OS=Sus scrofa OX=9823 GN=AK1 PE=1 SV=1
5	P39069	8.72e-130	364	194	0.902	0.902	KAD1_RAT Adenylate kinase isoenzyme 1 OS=Rattus norvegicus OX=10116 GN=Ak1 PE=1 SV=3
6	Q9R0Y5	2.74e-127	358	194	0.887	0.887	KAD1_MOUSE Adenylate kinase isoenzyme 1 OS=Mus musculus OX=10090 GN=Ak1 PE=1 SV=1
7	P05081	2.34e-117	333	194	0.830	0.830	KAD1_CHICK Adenylate kinase isoenzyme 1 OS=Gallus gallus OX=9031 GN=AK1 PE=1 SV=1
8	Q9Y6K8	1.04e-76	241	562	0.577	0.199	KAD5_HUMAN Adenylate kinase isoenzyme 5 OS=Homo sapiens OX=9606 GN=AK5 PE=1 SV=2
9	Q9VTV3	6.69e-60	187	201	0.469	0.453	Q9VTV3_DROME AT17975p OS=Drosophila melanogaster OX=7227 GN=Ak1 PE=1 SV=1
10	Q8IQG9	1.57e-59	187	229	0.469	0.397	Q8IQG9_DROME Adenylate kinase 1, isoform B OS=Drosophila melanogaster OX=7227 GN=Ak1 PE=1 SV=1
11	P15700	1.06e-52	169	204	0.428	0.407	KCY_YEAST Uridylate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=URA6 PE=1 SV=1
12	O04905	3.22e-52	168	202	0.433	0.416	KCY3_ARATH UMP-CMP kinase 3 OS=Arabidopsis thaliana OX=3702 GN=UMK3 PE=1 SV=1
13	Q8VY84	5.33e-49	160	204	0.412	0.392	KCY1_ARATH Probable UMP-CMP kinase 1 OS=Arabidopsis thaliana OX=3702 GN=UMK1 PE=2 SV=1
14	P30085	2.78e-48	157	196	0.402	0.398	KCY_HUMAN UMP-CMP kinase OS=Homo sapiens OX=9606 GN=CMPK1 PE=1 SV=3
15	Q4KM73	2.22e-47	155	196	0.402	0.398	KCY_RAT UMP-CMP kinase OS=Rattus norvegicus OX=10116 GN=Cmpk1 PE=1 SV=2
16	P20425	3.33e-46	152	195	0.428	0.426	KCY_DICDI UMP-CMP kinase OS=Dictyostelium discoideum OX=44689 GN=pyrK PE=1 SV=2
17	O59771	1.43e-45	150	191	0.407	0.414	KCY_SCHPO Uridylate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1795.05c PE=3 SV=1
18	Q6NMK6	3.90e-45	152	259	0.397	0.297	KCY2_ARATH Probable UMP-CMP kinase 2 OS=Arabidopsis thaliana OX=3702 GN=UMK2 PE=2 SV=2
19	Q9VBI2	1.93e-44	149	253	0.387	0.296	Q9VBI2_DROME UMP-CMP kinase OS=Drosophila melanogaster OX=7227 GN=Cmpk PE=1 SV=1
20	Q8IGD0	3.33e-43	148	304	0.381	0.243	Q8IGD0_DROME RH52725p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Cmpk PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	3.9e+02	12.9	ATPase family associated with various cellular activities (AAA)
2	PF13207 AAA_17	6.6e-34	128.7	AAA domain
3	PF13238 AAA_18	3.1e-05	35.9	AAA domain
4	PF13245 AAA_19	1e+02	14.5	AAA domain
5	PF13401 AAA_22	2.1e+02	13.6	AAA domain
6	PF13671 AAA_33	2.2e-05	36.1	AAA domain
7	PF00406 ADK	2.7e-49	178.6	Adenylate kinase
8	PF02224 Cytidylate_kin	28	15.9	Cytidylate kinase
9	PF01712 dNK	13	17.1	Deoxynucleoside kinase
10	PF03266 NTPase_1	1.7e+02	13.4	NTPase
11	PF02223 Thymidylate_kin	0.07	24.3	Thymidylate kinase
12	PF06414 Zeta_toxin	14	16.5	Zeta toxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362271

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000286621	0.974	Adenosine kinase
2	9606.ENSP00000367615	0.938	Adenine phosphoribosyltransferase
3	9606.ENSP00000485525	0.935	Adenylosuccinate lyase
4	9606.ENSP00000353165	0.931	Thiamin pyrophosphokinase 1
5	9606.ENSP00000300738	0.917	Ribonucleoside-diphosphate reductase large subunit
6	9606.ENSP00000347213	0.917	Ectonucleoside triphosphate diphosphohydrolase 2
7	9606.ENSP00000286648	0.911	Deoxycytidine kinase
8	9606.ENSP00000353770	0.904	Ribonucleoside-diphosphate reductase subunit M2
9	9606.ENSP00000251810	0.903	Ribonucleoside-diphosphate reductase subunit M2 B
10	9606.ENSP00000355587	0.901	Cancer-related nucleoside-triphosphatase
11	9606.ENSP00000301825	0.859	Ectonucleoside triphosphate diphosphohydrolase 3
12	9606.ENSP00000267584	0.853	Adenylate kinase 7
13	9606.ENSP00000376889	0.803	Nucleoside diphosphate kinase
14	9606.ENSP00000303356	0.800	L-xylulose reductase
15	9606.ENSP00000320171	0.797	Pyruvate kinase PKM
16	9606.ENSP00000226253	0.796	Belongs to the class I fructose-bisphosphate aldolase family
17	9606.ENSP00000376886	0.788	Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate (By similarity). Negatively regulates Rho activity by interacting with AKAP13/LBC . Acts as a transcriptional activator of the MYC gene
18	9606.ENSP00000410186	0.783	Adenylate kinase 9
19	9606.ENSP00000430075	0.775	AMP deaminase 1
20	9606.ENSP00000339933	0.764	Pyruvate kinase PKLR

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004017	1.000	adenylate kinase activity
GO:0005488	0.969	binding
GO:0043167	0.613	ion binding
GO:0005515	0.501	protein binding
GO:0004550	0.500	nucleoside diphosphate kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0044238	0.996	primary metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0044281	0.986	small molecule metabolic process
GO:0006793	0.986	phosphorus metabolic process
GO:0009058	0.985	biosynthetic process
GO:0044249	0.983	cellular biosynthetic process
GO:0006796	0.983	phosphate-containing compound metabolic process
GO:0019637	0.983	organophosphate metabolic process
GO:0006139	0.978	nucleobase-containing compound metabolic process
GO:0055086	0.968	nucleobase-containing small molecule metabolic process
GO:0009132	0.960	nucleoside diphosphate metabolic process
GO:1901293	0.954	nucleoside phosphate biosynthetic process
GO:0009117	0.947	nucleotide metabolic process
GO:1901564	0.730	organonitrogen compound metabolic process
GO:1901566	0.597	organonitrogen compound biosynthetic process
GO:1901135	0.570	carbohydrate derivative metabolic process
GO:0046939	0.479	nucleotide phosphorylation
GO:0009259	0.418	ribonucleotide metabolic process
GO:0065007	0.374	biological regulation
GO:0050789	0.326	regulation of biological process
GO:0050794	0.324	regulation of cellular process
GO:0009165	0.315	nucleotide biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043226	0.859	organelle
GO:0043227	0.838	membrane-bounded organelle
GO:0043229	0.778	intracellular organelle
GO:0043231	0.536	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:12973	1.000	AMP + ATP = 2 ADP
EC:2.7.4.3	1.000	adenylate kinase.
EC:2.7.4.6	0.500	nucleoside-diphosphate kinase.

[back to server]