StarFunc result for job id P00734

User Input

>input (622 residues)
MAHVRGLQLPGCLALAALCSLVHSQHVFLAPQQARSLLQRVRRANTFLEEVRKGNLEREC
VEETCSYEEAFEALESSTATDVFWAKYTACETARTPRDKLAACLEGNCAEGLGTNYRGHV
NITRSGIECQLWRSRYPHKPEINSTTHPGADLQENFCRNPDSSTTGPWCYTTDPTVRRQE
CSIPVCGQDQVTVAMTPRSEGSSVNLSPPLEQCVPDRGQQYQGRLAVTTHGLPCLAWASA
QAKALSKHQDFNSAVQLVENFCRNPDGDEEGVWCYVAGKPGDFGYCDLNYCEEAVEEETG
DGLDEDSDRAIEGRTATSEYQTFFNPRTFGSGEADCGLRPLFEKKSLEDKTERELLESYI
DGRIVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTEN
DLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHP
VCLPDRETAASLLQAGYKGRVTGWGNLKETWTANVGKGQPSVLQVVNLPIVERPVCKDST
RIRITDNMFCAGYKPDEGKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKY
GFYTHVFRLKKWIQKVIDQFGE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:5edmA	0.630	0.712	0.000	550	0.875	0.989	5edmA.pdb.gz	How the Linker Connecting the Two Kringles Influences Activation and Conformational Plasticity of Prothrombin.
2	AFDB:P00734	1.000	1.000	0.000	622	1.000	1.000	P00734.pdb.gz	THRB_HUMAN Prothrombin OS=Homo sapiens OX=9606 GN=F2 PE=1 SV=2
3	AFDB:P00735	0.862	0.858	1.729E-100	625	0.814	0.810	P00735.pdb.gz	THRB_BOVIN Prothrombin OS=Bos taurus OX=9913 GN=F2 PE=1 SV=2
4	AFDB:P19221	0.840	0.845	2.930E-98	618	0.812	0.817	P19221.pdb.gz	THRB_MOUSE Prothrombin OS=Mus musculus OX=10090 GN=F2 PE=1 SV=1
5	PDB:6bjrA	0.874	0.943	1.108E-89	575	0.913	0.988	6bjrA.pdb.gz	Structure of prothrombin in the closed form reveals new details on the mechanism of activation.
6	AFDB:E7FAN5	0.824	0.808	4.272E-81	635	0.539	0.528	E7FAN5.pdb.gz	E7FAN5_DANRE Prothrombin OS=Danio rerio OX=7955 GN=wu:fb57c10 PE=1 SV=1
7	AFDB:F1R704	0.468	0.538	2.574E-60	539	0.479	0.553	F1R704.pdb.gz
8	AFDB:P00747	0.347	0.269	1.630E-36	810	0.254	0.195	P00747.pdb.gz	PLMN_HUMAN Plasminogen OS=Homo sapiens OX=9606 GN=PLG PE=1 SV=2
9	AFDB:P06868	0.347	0.269	3.621E-36	812	0.252	0.193	P06868.pdb.gz	PLMN_BOVIN Plasminogen OS=Bos taurus OX=9913 GN=PLG PE=1 SV=2
10	AFDB:P20918	0.349	0.270	3.752E-35	812	0.241	0.185	P20918.pdb.gz	PLMN_MOUSE Plasminogen OS=Mus musculus OX=10090 GN=Plg PE=1 SV=3
11	AFDB:A4IGA7	0.404	0.358	3.806E-33	712	0.232	0.202	A4IGA7.pdb.gz
12	PDB:4a5tS	0.357	0.292	6.477E-33	767	0.244	0.198	4a5tS.pdb.gz
13	AFDB:A0A1D5PAR6	0.425	0.370	7.545E-33	726	0.217	0.186	A0A1D5PAR6.pdb.gz
14	PDB:4duuA	0.345	0.316	1.257E-31	682	0.248	0.226	4duuA.pdb.gz
15	PDB:6i44A	0.343	0.358	8.860E-21	594	0.151	0.158	6i44A.pdb.gz	Plasma kallikrein structure reveals apple domain disc rotated conformation compared to factor XI.
16	PDB:4bxwB	0.346	0.725	7.738E-20	287	0.143	0.310	4bxwB.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
17	PDB:6qfgA	0.318	0.837	7.738E-20	223	0.132	0.368	6qfgA.pdb.gz	Evaluation of a crystallographic surrogate for kallikrein 5 in the discovery of novel inhibitors for Netherton syndrome.
18	PDB:1a0lA	0.335	0.813	9.181E-20	244	0.143	0.365	1a0lA.pdb.gz	Human beta-tryptase is a ring-like tetramer with active sites facing a central pore.
19	PDB:4bnrA	0.332	0.829	1.293E-19	237	0.138	0.363	4bnrA.pdb.gz	Comparison of Complexes Formed by a Crustacean and a Vertebrate Trypsin with Bovine Pancreatic Trypsin Inhibitor - the Key to Achieving Extreme Stability?
20	PDB:5i25A	0.334	0.348	1.534E-19	596	0.140	0.146	5i25A.pdb.gz	A novel DFP tripeptide motif interacts with the coagulation factor XI apple 2 domain.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7FAN5	0.0	697	635	0.529	0.518	E7FAN5_DANRE Prothrombin OS=Danio rerio OX=7955 GN=wu:fb57c10 PE=1 SV=1
2	P00734	0.0	1301	622	1.000	1.000	THRB_HUMAN Prothrombin OS=Homo sapiens OX=9606 GN=F2 PE=1 SV=2
3	P00735	0.0	1069	625	0.814	0.810	THRB_BOVIN Prothrombin OS=Bos taurus OX=9913 GN=F2 PE=1 SV=2
4	P18292	0.0	1020	617	0.796	0.802	THRB_RAT Prothrombin OS=Rattus norvegicus OX=10116 GN=F2 PE=1 SV=1
5	P19221	0.0	1059	618	0.812	0.817	THRB_MOUSE Prothrombin OS=Mus musculus OX=10090 GN=F2 PE=1 SV=1
6	Q7SXH8	1.10e-175	511	524	0.387	0.460	Q7SXH8_DANRE Prothrombin OS=Danio rerio OX=7955 GN=zgc:66319 PE=1 SV=1
7	P06868	8.18e-67	235	812	0.265	0.203	PLMN_BOVIN Plasminogen OS=Bos taurus OX=9913 GN=PLG PE=1 SV=2
8	Q01177	3.11e-66	233	812	0.257	0.197	PLMN_RAT Plasminogen OS=Rattus norvegicus OX=10116 GN=Plg PE=2 SV=2
9	P20918	1.21e-65	232	812	0.257	0.197	PLMN_MOUSE Plasminogen OS=Mus musculus OX=10090 GN=Plg PE=1 SV=3
10	P08519	1.09e-63	230	2040	0.267	0.081	APOA_HUMAN Apolipoprotein(a) OS=Homo sapiens OX=9606 GN=LPA PE=1 SV=2
11	P00747	4.10e-63	225	810	0.270	0.207	PLMN_HUMAN Plasminogen OS=Homo sapiens OX=9606 GN=PLG PE=1 SV=2
12	Q63207	9.33e-49	179	482	0.162	0.210	FA10_RAT Coagulation factor X OS=Rattus norvegicus OX=10116 GN=F10 PE=2 SV=1
13	P04070	1.23e-48	178	461	0.175	0.236	PROC_HUMAN Vitamin K-dependent protein C OS=Homo sapiens OX=9606 GN=PROC PE=1 SV=1
14	P00742	2.70e-48	178	488	0.166	0.211	FA10_HUMAN Coagulation factor X OS=Homo sapiens OX=9606 GN=F10 PE=1 SV=2
15	P70521	4.68e-48	181	716	0.252	0.219	P70521_RAT Macrophage stimulating 1 (Hepatocyte growth factor-like) OS=Rattus norvegicus OX=10116 GN=Mst1 PE=2 SV=1
16	Q8K3U6	1.33e-47	175	446	0.203	0.283	FA7_RAT Coagulation factor VII OS=Rattus norvegicus OX=10116 GN=F7 PE=2 SV=1
17	Q90ZN6	7.74e-47	177	709	0.235	0.206	Q90ZN6_DANRE Hepatocyte growth factor-like 1 OS=Danio rerio OX=7955 GN=hgfl1 PE=2 SV=1
18	Q58L94	1.50e-46	172	453	0.159	0.219	FAXD2_NOTSC Venom prothrombin activator notecarin-D2 OS=Notechis scutatus scutatus OX=70142 PE=1 SV=1
19	P83370	3.42e-46	171	455	0.162	0.222	FAXD_HOPST Venom prothrombin activator hopsarin-D OS=Hoplocephalus stephensii OX=196418 PE=1 SV=2
20	P82807	2.27e-45	169	455	0.159	0.218	FAXD1_NOTSC Venom prothrombin activator notecarin-D1 OS=Notechis scutatus scutatus OX=70142 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11410 Antifungal_pept	5.6e+02	11.9	Antifungal peptide
2	PF09342 DUF1986	10	17.9	Domain of unknown function (DUF1986)
3	PF00594 Gla	1.3e-14	65.4	Vitamin K-dependent carboxylation/gamma-carboxyglutamic (GLA) domain
4	PF00051 Kringle	1.2e-45	165.0	Kringle domain
5	PF09396 Thrombin_light	2.2e-23	93.1	Thrombin light chain
6	PF00089 Trypsin	1.7e-64	229.2	Trypsin
7	PF13365 Trypsin_2	25	17.3	Trypsin-like peptidase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000308541

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000215727	0.999	Heparin cofactor 2
2	9606.ENSP00000306361	0.999	Fibrinogen alpha chain
3	9606.ENSP00000356671	0.999	Antithrombin-III
4	9606.ENSP00000366307	0.999	Thrombomodulin
5	9606.ENSP00000321326	0.998	Proteinase-activated receptor 1
6	9606.ENSP00000336829	0.998	Fibrinogen gamma chain
7	9606.ENSP00000306099	0.997	Fibrinogen beta chain
8	9606.ENSP00000248076	0.996	Proteinase-activated receptor 4
9	9606.ENSP00000181383	0.995	Carboxypeptidase B2
10	9606.ENSP00000296641	0.995	Proteinase-activated receptor 3
11	9606.ENSP00000234071	0.994	Vitamin K-dependent protein C
12	9606.ENSP00000333203	0.994	Plasma serine protease inhibitor
13	9606.ENSP00000329380	0.993	Platelet glycoprotein Ib alpha chain
14	9606.ENSP00000353393	0.992	Coagulation factor VIII
15	9606.ENSP00000334145	0.991	Tissue factor
16	9606.ENSP00000356771	0.990	Coagulation factor V
17	9606.ENSP00000233838	0.984	Vitamin K-dependent gamma-carboxylase
18	9606.ENSP00000261405	0.982	Von Willebrand factor
19	9606.ENSP00000216968	0.981	Endothelial protein C receptor
20	9606.ENSP00000393887	0.977	Alpha-2-HS-glycoprotein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004252	1.000	serine-type endopeptidase activity
GO:0005102	0.843	signaling receptor binding
GO:0098772	0.814	molecular function regulator activity
GO:0140677	0.525	molecular function activator activity
GO:0030545	0.469	signaling receptor regulator activity
GO:0030546	0.361	signaling receptor activator activity
GO:0097367	0.305	carbohydrate derivative binding
GO:0060089	0.304	molecular transducer activity
GO:0005539	0.301	glycosaminoglycan binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0050789	0.991	regulation of biological process
GO:0065008	0.990	regulation of biological quality
GO:0050896	0.988	response to stimulus
GO:0009987	0.980	cellular process
GO:0050878	0.971	regulation of body fluid levels
GO:0050794	0.969	regulation of cellular process
GO:0032501	0.968	multicellular organismal process
GO:0048518	0.932	positive regulation of biological process
GO:0048583	0.927	regulation of response to stimulus
GO:0071704	0.920	organic substance metabolic process
GO:0006950	0.875	response to stress
GO:0007596	0.857	blood coagulation
GO:0044238	0.852	primary metabolic process
GO:1903034	0.826	regulation of response to wounding
GO:0006807	0.819	nitrogen compound metabolic process
GO:0061041	0.792	regulation of wound healing
GO:1901564	0.789	organonitrogen compound metabolic process
GO:0043170	0.767	macromolecule metabolic process
GO:0050818	0.758	regulation of coagulation
GO:1900046	0.745	regulation of hemostasis
GO:0030193	0.741	regulation of blood coagulation
GO:0048584	0.735	positive regulation of response to stimulus
GO:0019538	0.711	protein metabolic process
GO:0051716	0.670	cellular response to stimulus
GO:0048519	0.636	negative regulation of biological process
GO:0090303	0.632	positive regulation of wound healing
GO:0048522	0.594	positive regulation of cellular process
GO:0007154	0.535	cell communication
GO:0023052	0.490	signaling
GO:0007165	0.470	signal transduction
GO:0019222	0.462	regulation of metabolic process
GO:0010646	0.460	regulation of cell communication
GO:0023051	0.439	regulation of signaling
GO:0048585	0.428	negative regulation of response to stimulus
GO:0060255	0.398	regulation of macromolecule metabolic process
GO:0080090	0.390	regulation of primary metabolic process
GO:0051241	0.388	negative regulation of multicellular organismal process
GO:0048523	0.385	negative regulation of cellular process
GO:0051171	0.376	regulation of nitrogen compound metabolic process
GO:0009966	0.362	regulation of signal transduction
GO:0032879	0.358	regulation of localization
GO:0065009	0.352	regulation of molecular function
GO:0042221	0.339	response to chemical
GO:0051240	0.334	positive regulation of multicellular organismal process
GO:0051049	0.301	regulation of transport
GO:0023056	0.301	positive regulation of signaling
GO:0010647	0.301	positive regulation of cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0031012	0.995	extracellular matrix
GO:0062023	0.979	collagen-containing extracellular matrix
GO:0005622	0.957	intracellular anatomical structure
GO:0043227	0.949	membrane-bounded organelle
GO:0016020	0.935	membrane
GO:0031982	0.919	vesicle
GO:0012505	0.905	endomembrane system
GO:0005886	0.901	plasma membrane
GO:0005737	0.897	cytoplasm
GO:0032991	0.872	protein-containing complex
GO:0043229	0.871	intracellular organelle
GO:0043231	0.858	intracellular membrane-bounded organelle
GO:0005615	0.822	extracellular space
GO:0070013	0.802	intracellular organelle lumen
GO:0005783	0.411	endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.21.-	1.000	Serine endopeptidases.

[back to server]