StarFunc result for job id P00747

User Input

>input (810 residues)
MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFT
CRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKN
GITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILE
CEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRE
LRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWS
AQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTE
QLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAG
LTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEED
CMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGG
PWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRT
RFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLE
PTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQ
LPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSW
GLGCARPNKPGVYVRVSRFVTWIEGVMRNN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:4a5tS	0.674	0.707	0.000	767	0.946	0.999	4a5tS.pdb.gz
2	PDB:4duuA	0.610	0.708	0.000	682	0.842	1.000	4duuA.pdb.gz
3	AFDB:P00747	1.000	1.000	0.000	810	1.000	1.000	P00747.pdb.gz	PLMN_HUMAN Plasminogen OS=Homo sapiens OX=9606 GN=PLG PE=1 SV=2
4	AFDB:P06868	0.723	0.721	0.000	812	0.780	0.778	P06868.pdb.gz	PLMN_BOVIN Plasminogen OS=Bos taurus OX=9913 GN=PLG PE=1 SV=2
5	AFDB:P20918	0.724	0.723	0.000	812	0.791	0.789	P20918.pdb.gz	PLMN_MOUSE Plasminogen OS=Mus musculus OX=10090 GN=Plg PE=1 SV=3
6	AFDB:P26928	0.281	0.317	1.060E-75	716	0.380	0.430	P26928.pdb.gz	HGFL_MOUSE Hepatocyte growth factor-like protein OS=Mus musculus OX=10090 GN=Mst1 PE=2 SV=2
7	AFDB:P26927	0.274	0.311	1.185E-75	711	0.379	0.432	P26927.pdb.gz	HGFL_HUMAN Hepatocyte growth factor-like protein OS=Homo sapiens OX=9606 GN=MST1 PE=1 SV=2
8	AFDB:F7FMS0	0.281	0.307	4.280E-75	739	0.380	0.417	F7FMS0.pdb.gz	F7FMS0_RAT Macrophage stimulating 1 OS=Rattus norvegicus OX=10116 GN=Mst1 PE=4 SV=1
9	AFDB:A0A1D5PAR6	0.261	0.284	2.417E-74	726	0.360	0.402	A0A1D5PAR6.pdb.gz
10	AFDB:Q5XFY1	0.276	0.315	6.515E-73	709	0.362	0.413	Q5XFY1.pdb.gz
11	AFDB:A4IGA7	0.265	0.300	1.204E-72	712	0.341	0.388	A4IGA7.pdb.gz
12	AFDB:F6PA78	0.271	0.319	1.964E-71	685	0.330	0.390	F6PA78.pdb.gz
13	PDB:5edmA	0.274	0.397	1.754E-33	550	0.189	0.278	5edmA.pdb.gz	How the Linker Connecting the Two Kringles Influences Activation and Conformational Plasticity of Prothrombin.
14	PDB:6bjrA	0.257	0.354	2.953E-26	575	0.191	0.270	6bjrA.pdb.gz	Structure of prothrombin in the closed form reveals new details on the mechanism of activation.
15	PDB:1cgiE	0.283	0.907	1.009E-25	245	0.117	0.388	1cgiE.pdb.gz
16	PDB:1fiwA	0.264	0.796	4.073E-25	260	0.106	0.331	1fiwA.pdb.gz	Effector sites in the three-dimensional structure of mammalian sperm beta-acrosin.
17	PDB:2a7jA	0.269	0.881	1.177E-24	240	0.112	0.379	2a7jA.pdb.gz	On the routine use of soft X-rays in macromolecular crystallography. Part III. The optimal data-collection wavelength.
18	PDB:4bnrA	0.265	0.877	1.177E-24	237	0.100	0.342	4bnrA.pdb.gz	Comparison of Complexes Formed by a Crustacean and a Vertebrate Trypsin with Bovine Pancreatic Trypsin Inhibitor - the Key to Achieving Extreme Stability?
19	PDB:2a31A	0.255	0.890	1.316E-24	223	0.122	0.444	2a31A.pdb.gz	NMR and crystallographic characterization of adventitious borate binding by trypsin.
20	PDB:1a0lA	0.260	0.829	7.855E-24	244	0.114	0.377	1a0lA.pdb.gz	Human beta-tryptase is a ring-like tetramer with active sites facing a central pore.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P00747	0.0	1686	810	1.000	1.000	PLMN_HUMAN Plasminogen OS=Homo sapiens OX=9606 GN=PLG PE=1 SV=2
2	P06868	0.0	1313	812	0.781	0.780	PLMN_BOVIN Plasminogen OS=Bos taurus OX=9913 GN=PLG PE=1 SV=2
3	P08519	0.0	1022	2040	0.619	0.246	APOA_HUMAN Apolipoprotein(a) OS=Homo sapiens OX=9606 GN=LPA PE=1 SV=2
4	P20918	0.0	1327	812	0.794	0.792	PLMN_MOUSE Plasminogen OS=Mus musculus OX=10090 GN=Plg PE=1 SV=3
5	Q01177	0.0	1303	812	0.791	0.789	PLMN_RAT Plasminogen OS=Rattus norvegicus OX=10116 GN=Plg PE=2 SV=2
6	Q90ZN6	3.73e-151	461	709	0.320	0.365	Q90ZN6_DANRE Hepatocyte growth factor-like 1 OS=Danio rerio OX=7955 GN=hgfl1 PE=2 SV=1
7	P70521	2.00e-149	457	716	0.320	0.362	P70521_RAT Macrophage stimulating 1 (Hepatocyte growth factor-like) OS=Rattus norvegicus OX=10116 GN=Mst1 PE=2 SV=1
8	Q08048	1.19e-148	455	728	0.314	0.349	HGF_MOUSE Hepatocyte growth factor OS=Mus musculus OX=10090 GN=Hgf PE=1 SV=1
9	P26928	1.91e-148	454	716	0.317	0.359	HGFL_MOUSE Hepatocyte growth factor-like protein OS=Mus musculus OX=10090 GN=Mst1 PE=2 SV=2
10	P26927	3.68e-148	453	711	0.322	0.367	HGFL_HUMAN Hepatocyte growth factor-like protein OS=Homo sapiens OX=9606 GN=MST1 PE=1 SV=2
11	F7FMS0	6.00e-148	454	739	0.322	0.353	F7FMS0_RAT Macrophage stimulating 1 OS=Rattus norvegicus OX=10116 GN=Mst1 PE=4 SV=1
12	P17945	1.37e-147	452	728	0.312	0.348	HGF_RAT Hepatocyte growth factor OS=Rattus norvegicus OX=10116 GN=Hgf PE=1 SV=1
13	Q90978	3.68e-144	443	726	0.319	0.355	Q90978_CHICK Hepatocyte growth factor OS=Gallus gallus OX=9031 GN=HGF PE=2 SV=3
14	P14210	3.94e-144	443	728	0.306	0.341	HGF_HUMAN Hepatocyte growth factor OS=Homo sapiens OX=9606 GN=HGF PE=1 SV=2
15	F1REK1	1.43e-130	407	712	0.298	0.338	F1REK1_DANRE Hepatocyte growth factor OS=Danio rerio OX=7955 GN=hgf1 PE=3 SV=1
16	Q5RGG3	3.81e-129	404	699	0.294	0.340	Q5RGG3_DANRE Hepatocyte growth factor OS=Danio rerio OX=7955 GN=hgf1 PE=3 SV=1
17	Q788Q2	2.79e-100	318	405	0.217	0.435	Q788Q2_CHICK HGF protein ( SFprotein ) (Fragment) OS=Gallus gallus OX=9031 GN=HGF PE=2 SV=1
18	A6PVI2	2.31e-95	296	166	0.184	0.898	A6PVI2_HUMAN Plasminogen OS=Homo sapiens OX=9606 GN=PLG PE=1 SV=2
19	Q5TEH5	8.84e-91	283	136	0.168	1.000	Q5TEH5_HUMAN HCG2029799, isoform CRA_b OS=Homo sapiens OX=9606 GN=PLG PE=1 SV=1
20	P00735	1.36e-67	238	625	0.201	0.261	THRB_BOVIN Prothrombin OS=Bos taurus OX=9913 GN=F2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09342 DUF1986	0.01	27.6	Domain of unknown function (DUF1986)
2	PF12516 DUF3719	5.2e+02	11.8	Protein of unknown function (DUF3719)
3	PF00051 Kringle	5.2e-144	480.2	Kringle domain
4	PF00024 PAN_1	1.2e-09	49.4	PAN domain
5	PF00089 Trypsin	1.8e-62	222.6	Trypsin
6	PF13365 Trypsin_2	0.00018	34.0	Trypsin-like peptidase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000308938

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000232003	0.999	Histidine-rich glycoprotein
2	9606.ENSP00000339328	0.999	Urokinase plasminogen activator surface receptor
3	9606.ENSP00000346032	0.999	Annexin A2
4	9606.ENSP00000357801	0.999	Protein S100-A10
5	9606.ENSP00000321853	0.998	Alpha-2-antiplasmin
6	9606.ENSP00000234590	0.996	Alpha-enolase
7	9606.ENSP00000223095	0.995	Plasminogen activator inhibitor 1
8	9606.ENSP00000346839	0.992	Fibronectin type III domain containing
9	9606.ENSP00000226218	0.991	Vitronectin
10	9606.ENSP00000296130	0.991	Tetranectin
11	9606.ENSP00000229239	0.990	Glyceraldehyde-3-phosphate dehydrogenase
12	9606.ENSP00000263816	0.988	Low-density lipoprotein receptor-related protein 2
13	9606.ENSP00000370473	0.988	Insulin-like growth factor-binding protein 3
14	9606.ENSP00000262113	0.987	Myomesin-2
15	9606.ENSP00000368752	0.987	Major prion protein
16	9606.ENSP00000401645	0.987	Plasminogen activator inhibitor 2
17	9606.ENSP00000361405	0.984	Matrix metalloproteinase-9
18	9606.ENSP00000223864	0.982	Plasminogen receptor (KT)
19	9606.ENSP00000356671	0.982	Antithrombin-III
20	9606.ENSP00000299855	0.980	Stromelysin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008236	0.998	serine-type peptidase activity
GO:0019899	0.995	enzyme binding
GO:0004175	0.994	endopeptidase activity
GO:0005102	0.990	signaling receptor binding
GO:0004252	0.967	serine-type endopeptidase activity
GO:0019904	0.825	protein domain specific binding
GO:0019900	0.555	kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.985	biological regulation
GO:0032501	0.983	multicellular organismal process
GO:0050896	0.982	response to stimulus
GO:0050789	0.979	regulation of biological process
GO:0050794	0.972	regulation of cellular process
GO:0009987	0.948	cellular process
GO:0071704	0.925	organic substance metabolic process
GO:0048583	0.900	regulation of response to stimulus
GO:0048518	0.883	positive regulation of biological process
GO:0006950	0.881	response to stress
GO:0044238	0.879	primary metabolic process
GO:0006807	0.814	nitrogen compound metabolic process
GO:0048522	0.799	positive regulation of cellular process
GO:0048519	0.791	negative regulation of biological process
GO:0043170	0.784	macromolecule metabolic process
GO:0065008	0.779	regulation of biological quality
GO:0050878	0.759	regulation of body fluid levels
GO:0051241	0.753	negative regulation of multicellular organismal process
GO:0006508	0.740	proteolysis
GO:0032101	0.717	regulation of response to external stimulus
GO:0080134	0.710	regulation of response to stress
GO:0048856	0.562	anatomical structure development
GO:1903034	0.542	regulation of response to wounding
GO:0048523	0.523	negative regulation of cellular process
GO:0019222	0.499	regulation of metabolic process
GO:0048585	0.497	negative regulation of response to stimulus
GO:0060255	0.480	regulation of macromolecule metabolic process
GO:0051716	0.478	cellular response to stimulus
GO:0048584	0.476	positive regulation of response to stimulus
GO:0040012	0.443	regulation of locomotion
GO:0071840	0.421	cellular component organization or biogenesis
GO:0032102	0.415	negative regulation of response to external stimulus
GO:0061041	0.399	regulation of wound healing
GO:0050818	0.391	regulation of coagulation
GO:1900046	0.391	regulation of hemostasis
GO:2000145	0.390	regulation of cell motility
GO:0016043	0.382	cellular component organization
GO:0030155	0.359	regulation of cell adhesion
GO:0040017	0.352	positive regulation of locomotion
GO:0051240	0.347	positive regulation of multicellular organismal process
GO:0030334	0.342	regulation of cell migration
GO:0007275	0.334	multicellular organism development
GO:0023052	0.332	signaling
GO:0007154	0.328	cell communication
GO:0042127	0.324	regulation of cell population proliferation
GO:0010468	0.313	regulation of gene expression
GO:0080090	0.310	regulation of primary metabolic process
GO:0009893	0.307	positive regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.998	cell periphery
GO:0005615	0.997	extracellular space
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0016020	0.995	membrane
GO:0012505	0.982	endomembrane system
GO:0005737	0.979	cytoplasm
GO:0005886	0.966	plasma membrane
GO:0070013	0.926	intracellular organelle lumen
GO:0031982	0.904	vesicle
GO:0030141	0.858	secretory granule
GO:0031012	0.778	extracellular matrix
GO:0062023	0.751	collagen-containing extracellular matrix
GO:0070062	0.716	extracellular exosome
GO:0009986	0.660	cell surface
GO:0031983	0.606	vesicle lumen
GO:0034774	0.601	secretory granule lumen
GO:0005634	0.317	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	1.000	Acting on peptide bonds (peptidases).
EC:3.4.21.-	0.967	Serine endopeptidases.

[back to server]