StarFunc result for job id P00748

User Input

>input (615 residues)
MRALLLLGFLLVSLESTLSIPPWEAPKEHKYKAEEHTVVLTVTGEPCHFPFQYHRQLYHK
CTHKGRPGPQPWCATTPNFDQDQRWGYCLEPKKVKDHCSKHSPCQKGGTCVNMPSGPHCL
CPQHLTGNHCQKEKCFEPQLLRFFHKNEIWYRTEQAAVARCQCKGPDAHCQRLASQACRT
NPCLHGGRCLEVEGHRLCHCPVGYTGAFCDVDTKASCYDGRGLSYRGLARTTLSGAPCQP
WASEATYRNVTAEQARNWGLGGHAFCRNPDNDIRPWCFVLNRDRLSWEYCDLAQCQTPTQ
AAPPTPVSPRLHVPLMPAQPAPPKPQPTTRTPPQSQTPGALPAKREQPPSLTRNGPLSCG
QRLRKSLSSMTRVVGGLVALRGAHPYIAALYWGHSFCAGSLIAPCWVLTAAHCLQDRPAP
EDLTVVLGQERRNHSCEPCQTLAVRSYRLHEAFSPVSYQHDLALLRLQEDADGSCALLSP
YVQPVCLPSGAARPSETTLCQVAGWGHQFEGAEEYASFLQEAQVPFLSLERCSAPDVHGS
SILPGMLCAGFLEGGTDACQGDSGGPLVCEDQAAERRLTLQGIISWGSGCGDRNKPGVYT
DVAYYLAWIREHTVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P00748	1.000	1.000	0.000	615	1.000	1.000	P00748.pdb.gz	FA12_HUMAN Coagulation factor XII OS=Homo sapiens OX=9606 GN=F12 PE=1 SV=3
2	AFDB:D3ZTE0	0.505	0.520	2.789E-95	595	0.712	0.736	D3ZTE0.pdb.gz	FA12_RAT Coagulation factor XII OS=Rattus norvegicus OX=10116 GN=F12 PE=2 SV=1
3	AFDB:Q80YC5	0.512	0.526	3.030E-94	597	0.706	0.727	Q80YC5.pdb.gz	FA12_MOUSE Coagulation factor XII OS=Mus musculus OX=10090 GN=F12 PE=1 SV=2
4	AFDB:Q9R098	0.502	0.479	1.574E-62	653	0.398	0.375	Q9R098.pdb.gz	HGFA_MOUSE Hepatocyte growth factor activator OS=Mus musculus OX=10090 GN=Hgfac PE=1 SV=1
5	AFDB:Q04756	0.525	0.502	8.449E-62	655	0.387	0.363	Q04756.pdb.gz	HGFA_HUMAN Hepatocyte growth factor activator OS=Homo sapiens OX=9606 GN=HGFAC PE=1 SV=1
6	AFDB:Q800Y7	0.454	0.502	1.457E-59	540	0.340	0.387	Q800Y7.pdb.gz	Q800Y7_MELGA Hepatocyte growth factor activator (Fragment) OS=Meleagris gallopavo OX=9103 PE=2 SV=1
7	AFDB:P00750	0.387	0.423	2.791E-42	562	0.280	0.306	P00750.pdb.gz	TPA_HUMAN Tissue-type plasminogen activator OS=Homo sapiens OX=9606 GN=PLAT PE=1 SV=1
8	AFDB:P29598	0.401	0.566	1.176E-40	432	0.249	0.354	P29598.pdb.gz	UROK_RAT Urokinase-type plasminogen activator OS=Rattus norvegicus OX=10116 GN=Plau PE=1 SV=1
9	AFDB:Q05589	0.394	0.554	1.868E-39	433	0.249	0.353	Q05589.pdb.gz	UROK_BOVIN Urokinase-type plasminogen activator OS=Bos taurus OX=9913 GN=PLAU PE=2 SV=1
10	AFDB:P00749	0.392	0.553	3.989E-39	431	0.247	0.353	P00749.pdb.gz	UROK_HUMAN Urokinase-type plasminogen activator OS=Homo sapiens OX=9606 GN=PLAU PE=1 SV=3
11	PDB:4a5tS	0.353	0.286	2.587E-27	767	0.272	0.218	4a5tS.pdb.gz
12	PDB:4duuA	0.350	0.317	4.696E-27	682	0.259	0.233	4duuA.pdb.gz
13	PDB:1fiwA	0.364	0.844	7.897E-24	260	0.141	0.335	1fiwA.pdb.gz	Effector sites in the three-dimensional structure of mammalian sperm beta-acrosin.
14	PDB:4h4fA	0.357	0.898	3.413E-23	239	0.133	0.343	4h4fA.pdb.gz	Long-range Electrostatic Complementarity Governs Substrate Recognition by Human Chymotrypsin C, a Key Regulator of Digestive Enzyme Activation.
15	PDB:2a7jA	0.352	0.878	4.476E-23	240	0.137	0.350	2a7jA.pdb.gz	On the routine use of soft X-rays in macromolecular crystallography. Part III. The optimal data-collection wavelength.
16	PDB:4bnrA	0.351	0.890	5.560E-23	237	0.140	0.363	4bnrA.pdb.gz	Comparison of Complexes Formed by a Crustacean and a Vertebrate Trypsin with Bovine Pancreatic Trypsin Inhibitor - the Key to Achieving Extreme Stability?
17	PDB:2a31A	0.342	0.918	1.398E-22	223	0.145	0.399	2a31A.pdb.gz	NMR and crystallographic characterization of adventitious borate binding by trypsin.
18	PDB:2ra3A	0.343	0.918	2.679E-22	224	0.137	0.375	2ra3A.pdb.gz	Structural Basis for Accelerated Cleavage of Bovine Pancreatic Trypsin Inhibitor (BPTI) by Human Mesotrypsin.
19	PDB:6i44A	0.344	0.356	4.133E-22	594	0.135	0.140	6i44A.pdb.gz	Plasma kallikrein structure reveals apple domain disc rotated conformation compared to factor XI.
20	PDB:6qfgA	0.332	0.886	5.134E-22	223	0.141	0.390	6qfgA.pdb.gz	Evaluation of a crystallographic surrogate for kallikrein 5 in the discovery of novel inhibitors for Netherton syndrome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZTE0	0.0	894	595	0.714	0.738	FA12_RAT Coagulation factor XII OS=Rattus norvegicus OX=10116 GN=F12 PE=2 SV=1
2	P00748	0.0	1263	615	1.000	1.000	FA12_HUMAN Coagulation factor XII OS=Homo sapiens OX=9606 GN=F12 PE=1 SV=3
3	Q80YC5	0.0	895	597	0.706	0.727	FA12_MOUSE Coagulation factor XII OS=Mus musculus OX=10090 GN=F12 PE=1 SV=2
4	Q9R098	3.03e-145	437	653	0.395	0.372	HGFA_MOUSE Hepatocyte growth factor activator OS=Mus musculus OX=10090 GN=Hgfac PE=1 SV=1
5	Q04756	2.01e-141	427	655	0.390	0.366	HGFA_HUMAN Hepatocyte growth factor activator OS=Homo sapiens OX=9606 GN=HGFAC PE=1 SV=1
6	Q800Y7	3.49e-134	405	540	0.337	0.383	Q800Y7_MELGA Hepatocyte growth factor activator (Fragment) OS=Meleagris gallopavo OX=9103 PE=2 SV=1
7	G1NJS7	2.04e-97	305	404	0.257	0.391	G1NJS7_MELGA Uncharacterized protein OS=Meleagris gallopavo OX=9103 PE=4 SV=2
8	P00750	6.25e-80	265	562	0.283	0.310	TPA_HUMAN Tissue-type plasminogen activator OS=Homo sapiens OX=9606 GN=PLAT PE=1 SV=1
9	P19637	1.94e-76	255	559	0.268	0.295	TPA_RAT Tissue-type plasminogen activator OS=Rattus norvegicus OX=10116 GN=Plat PE=2 SV=2
10	Q28198	2.02e-76	255	566	0.281	0.306	TPA_BOVIN Tissue-type plasminogen activator OS=Bos taurus OX=9913 GN=PLAT PE=2 SV=1
11	P00749	8.06e-76	250	431	0.252	0.360	UROK_HUMAN Urokinase-type plasminogen activator OS=Homo sapiens OX=9606 GN=PLAU PE=1 SV=3
12	Q05589	3.89e-75	248	433	0.255	0.363	UROK_BOVIN Urokinase-type plasminogen activator OS=Bos taurus OX=9913 GN=PLAU PE=2 SV=1
13	P11214	1.81e-74	250	559	0.268	0.295	TPA_MOUSE Tissue-type plasminogen activator OS=Mus musculus OX=10090 GN=Plat PE=1 SV=3
14	P29598	2.06e-74	246	432	0.250	0.356	UROK_RAT Urokinase-type plasminogen activator OS=Rattus norvegicus OX=10116 GN=Plau PE=1 SV=1
15	Q6L711	4.43e-70	238	558	0.296	0.326	HABP2_RAT Hyaluronan-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Habp2 PE=2 SV=1
16	P06869	1.31e-69	234	433	0.246	0.349	UROK_MOUSE Urokinase-type plasminogen activator OS=Mus musculus OX=10090 GN=Plau PE=1 SV=1
17	Q14520	1.35e-69	237	560	0.294	0.323	HABP2_HUMAN Hyaluronan-binding protein 2 OS=Homo sapiens OX=9606 GN=HABP2 PE=1 SV=1
18	G8CXX6	1.52e-68	231	432	0.244	0.347	G8CXX6_DANRE Plasminogen activator, urokinase b OS=Danio rerio OX=7955 GN=wu:fk07g01 PE=2 SV=1
19	D3GE88	4.14e-64	218	402	0.221	0.338	D3GE88_DANRE Plasminogen activator, urokinase a OS=Danio rerio OX=7955 GN=si:dkey-252g6.1 PE=2 SV=1
20	P06868	3.93e-54	199	812	0.237	0.180	PLMN_BOVIN Plasminogen OS=Bos taurus OX=9913 GN=PLG PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09342 DUF1986	44	15.9	Domain of unknown function (DUF1986)
2	PF00008 EGF	2.7e-08	45.3	EGF-like domain
3	PF07974 EGF_2	20	17.0	EGF-like domain
4	PF00039 fn1	1.6e-07	42.7	Fibronectin type I domain
5	PF00040 fn2	1.1e-13	62.4	Fibronectin type II domain
6	PF12661 hEGF	14	17.8	Human growth factor-like EGF
7	PF00051 Kringle	1.8e-20	84.3	Kringle domain
8	PF00089 Trypsin	7.1e-60	214.1	Trypsin
9	PF13365 Trypsin_2	0.0086	28.5	Trypsin-like peptidase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000253496

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265023	0.996	Kininogen-1
2	9606.ENSP00000225698	0.986	Complement component 1 Q subcomponent-binding protein, mitochondrial
3	9606.ENSP00000278407	0.980	Plasma protease C1 inhibitor
4	9606.ENSP00000329380	0.975	Platelet glycoprotein Ib alpha chain
5	9606.ENSP00000264690	0.969	Plasma kallikrein
6	9606.ENSP00000356671	0.963	Antithrombin-III
7	9606.ENSP00000384957	0.962	Coagulation factor XI
8	9606.ENSP00000308541	0.948	Prothrombin
9	9606.ENSP00000383382	0.912	Platelet glycoprotein Ib beta chain
10	9606.ENSP00000303942	0.904	Platelet glycoprotein IX
11	9606.ENSP00000331902	0.903	Collagen alpha-5(IV) chain
12	9606.ENSP00000353654	0.903	Collagen alpha-2(IV) chain
13	9606.ENSP00000364979	0.903	Collagen alpha-1(IV) chain
14	9606.ENSP00000378340	0.903	Collagen alpha-6(IV) chain
15	9606.ENSP00000379823	0.903	Collagen alpha-3(IV) chain
16	9606.ENSP00000379866	0.903	Collagen alpha-4(IV) chain
17	9606.ENSP00000383931	0.902	Platelet glycoprotein V
18	9606.ENSP00000218099	0.871	Coagulation factor IX
19	9606.ENSP00000308938	0.865	Plasminogen
20	9606.ENSP00000353785	0.725	Tubulin polymerization-promoting protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004252	1.000	serine-type endopeptidase activity
GO:0051787	0.991	misfolded protein binding
GO:0005102	0.438	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0019538	0.985	protein metabolic process
GO:0065007	0.983	biological regulation
GO:0050896	0.982	response to stimulus
GO:0032501	0.982	multicellular organismal process
GO:0006508	0.967	proteolysis
GO:0050789	0.954	regulation of biological process
GO:0007596	0.907	blood coagulation
GO:0048519	0.892	negative regulation of biological process
GO:0051604	0.879	protein maturation
GO:0032102	0.878	negative regulation of response to external stimulus
GO:0030193	0.835	regulation of blood coagulation
GO:0051241	0.798	negative regulation of multicellular organismal process
GO:1900047	0.776	negative regulation of hemostasis
GO:1903035	0.776	negative regulation of response to wounding
GO:0050819	0.774	negative regulation of coagulation
GO:0030195	0.747	negative regulation of blood coagulation
GO:0048518	0.703	positive regulation of biological process
GO:0009987	0.526	cellular process
GO:0050794	0.453	regulation of cellular process
GO:0019222	0.343	regulation of metabolic process
GO:0048584	0.305	positive regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.998	extracellular space
GO:0071944	0.985	cell periphery
GO:0043227	0.977	membrane-bounded organelle
GO:0070013	0.951	intracellular organelle lumen
GO:0005737	0.932	cytoplasm
GO:0012505	0.917	endomembrane system
GO:0031012	0.898	extracellular matrix
GO:0016020	0.877	membrane
GO:0005886	0.866	plasma membrane
GO:0062023	0.862	collagen-containing extracellular matrix
GO:1903561	0.856	extracellular vesicle
GO:0070062	0.854	extracellular exosome
GO:0043231	0.744	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.21.-	1.000	Serine endopeptidases.

[back to server]