StarFunc result for job id P00813

User Input

>input (363 residues)
MAQTPAFDKPKVELHVHLDGSIKPETILYYGRRRGIALPANTAEGLLNVIGMDKPLTLPD
FLAKFDYYMPAIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVEPIPWNQA
EGDLTPDEVVALVGQGLQEGERDFGVKARSILCCMRHQPNWSPKVVELCKKYQQQTVVAI
DLAGDETIPGSSLLPGHVQAYQEAVKSGIHRTVHAGEVGSAEVVKEAVDILKTERLGHGY
HTLEDQALYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRLKNDQANYSLNTDDPLIF
KSTLDTDYQMTKRDMGFTEEEFKRLNINAAKSSFLPEDEKRELLDLLYKAYGMPPSASAG
QNL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0S2Z381	0.999	0.999	1.987E-68	363	1.000	1.000	A0A0S2Z381.pdb.gz	A0A0S2Z381_HUMAN Adenosine deaminase (Fragment) OS=Homo sapiens OX=9606 GN=ADA PE=2 SV=1
2	AFDB:P56658	0.988	0.988	6.340E-62	363	0.887	0.887	P56658.pdb.gz	ADA_BOVIN Adenosine deaminase OS=Bos taurus OX=9913 GN=ADA PE=1 SV=3
3	PDB:3iarA	0.976	0.984	2.518E-61	360	0.986	0.994	3iarA.pdb.gz	The crystal structure of human adenosine deaminase
4	AFDB:P03958	0.966	0.996	2.557E-58	352	0.807	0.832	P03958.pdb.gz	ADA_MOUSE Adenosine deaminase OS=Mus musculus OX=10090 GN=Ada PE=1 SV=3
5	AFDB:F5GWI4	0.913	0.977	6.941E-58	339	0.934	1.000	F5GWI4.pdb.gz	F5GWI4_HUMAN Adenosine deaminase OS=Homo sapiens OX=9606 GN=ADA PE=1 SV=1
6	PDB:1a4lA	0.957	0.995	8.308E-57	349	0.799	0.831	1a4lA.pdb.gz	Complexes of adenosine deaminase with two potent inhibitors: X-ray structures in four independent molecules at pH of maximum activity.
7	AFDB:Q6DG22	0.966	0.976	1.254E-50	359	0.642	0.649	Q6DG22.pdb.gz	ADA_DANRE Adenosine deaminase OS=Danio rerio OX=7955 GN=ada PE=2 SV=2
8	AFDB:P22333	0.830	0.902	3.318E-25	333	0.295	0.321	P22333.pdb.gz	ADD_ECOLI Adenosine deaminase OS=Escherichia coli (strain K12) OX=83333 GN=add PE=1 SV=2
9	AFDB:Q9P6I7	0.830	0.822	1.459E-23	367	0.248	0.245	Q9P6I7.pdb.gz	ADE_SCHPO Adenine deaminase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=aah1 PE=1 SV=1
10	AFDB:P53909	0.792	0.826	7.438E-23	347	0.248	0.259	P53909.pdb.gz	ADE_YEAST Adenine deaminase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AAH1 PE=1 SV=1
11	AFDB:Q9RDE5	0.781	0.830	1.326E-22	340	0.253	0.271	Q9RDE5.pdb.gz	ADE_STRCO Adenine deaminase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) OX=100226 GN=SCO2546 PE=3 SV=1
12	AFDB:Q9I6Y4	0.792	0.903	1.552E-22	316	0.226	0.259	Q9I6Y4.pdb.gz	ADE_PSEAE Adenine deaminase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA0148 PE=1 SV=1
13	PDB:3ou8B	0.784	0.899	2.155E-22	314	0.220	0.255	3ou8B.pdb.gz	The crystal structure of adenosine deaminase from Pseudomonas aeruginosa
14	PDB:6ii7A	0.788	0.804	2.394E-22	355	0.240	0.245	6ii7A.pdb.gz	Crystal structure of Plasmodium falciparum adenosine deaminase reveals a novel binding pocket for inosine.
15	PDB:3ewdA	0.817	0.815	5.366E-20	364	0.248	0.247	3ewdA.pdb.gz	Structural and metabolic specificity of methylthiocoformycin for malarial adenosine deaminases.
16	PDB:6ijnA	0.793	0.841	2.124E-18	341	0.242	0.258	6ijnA.pdb.gz	Alternative conformation induced by substrate binding for Arabidopsis thalianaN6-methyl-AMP deaminase.
17	PDB:6ohbA	0.544	0.465	7.106E-7	435	0.129	0.108	6ohbA.pdb.gz	Structural Determinants for Substrate Selectivity in Guanine Deaminase Enzymes of the Amidohydrolase Superfamily.
18	PDB:2uz9A	0.508	0.431	1.830E-6	444	0.110	0.090	2uz9A.pdb.gz	Human Guanine Deaminase (Guad) in Complex with Zinc and its Product Xhantine
19	PDB:6oh9A	0.536	0.443	5.814E-6	452	0.157	0.126	6oh9A.pdb.gz	Structural Determinants for Substrate Selectivity in Guanine Deaminase Enzymes of the Amidohydrolase Superfamily.
20	PDB:3g77A	0.475	0.417	7.561E-6	423	0.127	0.109	3g77A.pdb.gz	Bacterial cytosine deaminase mutants created by molecular engineering show improved 5-fluorocytosine-mediated cell killing in vitro and in vivo.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z381	0.0	758	363	1.000	1.000	A0A0S2Z381_HUMAN Adenosine deaminase (Fragment) OS=Homo sapiens OX=9606 GN=ADA PE=2 SV=1
2	F5GWI4	0.0	698	339	0.934	1.000	F5GWI4_HUMAN Adenosine deaminase OS=Homo sapiens OX=9606 GN=ADA PE=1 SV=1
3	P00813	0.0	758	363	1.000	1.000	ADA_HUMAN Adenosine deaminase OS=Homo sapiens OX=9606 GN=ADA PE=1 SV=3
4	P03958	0.0	618	352	0.807	0.832	ADA_MOUSE Adenosine deaminase OS=Mus musculus OX=10090 GN=Ada PE=1 SV=3
5	P56658	0.0	684	363	0.887	0.887	ADA_BOVIN Adenosine deaminase OS=Bos taurus OX=9913 GN=ADA PE=1 SV=3
6	Q920P6	0.0	649	352	0.829	0.855	ADA_RAT Adenosine deaminase OS=Rattus norvegicus OX=10116 GN=Ada PE=1 SV=3
7	Q6DG22	1.75e-173	488	359	0.645	0.652	ADA_DANRE Adenosine deaminase OS=Danio rerio OX=7955 GN=ada PE=2 SV=2
8	P22333	2.59e-45	160	333	0.309	0.336	ADD_ECOLI Adenosine deaminase OS=Escherichia coli (strain K12) OX=83333 GN=add PE=1 SV=2
9	Q9P6I7	1.36e-30	121	367	0.259	0.256	ADE_SCHPO Adenine deaminase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=aah1 PE=1 SV=1
10	Q9I6Y4	7.65e-30	118	316	0.234	0.269	ADE_PSEAE Adenine deaminase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA0148 PE=1 SV=1
11	A0A0K1SC59	1.13e-29	119	362	0.273	0.273	ADA_PLAGA Adenosine deaminase OS=Plasmodium gallinaceum OX=5849 GN=ADA PE=1 SV=1
12	A0A1Y3DYH2	2.44e-26	110	363	0.270	0.270	ADA_PLAKN Adenosine deaminase OS=Plasmodium knowlesi OX=5850 GN=ADA PE=1 SV=1
13	Q9RDE5	3.57e-26	108	340	0.242	0.259	ADE_STRCO Adenine deaminase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) OX=100226 GN=SCO2546 PE=3 SV=1
14	P53909	4.93e-26	108	347	0.248	0.259	ADE_YEAST Adenine deaminase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AAH1 PE=1 SV=1
15	A0A509ALD0	8.27e-26	108	363	0.267	0.267	ADA_PLABA Adenosine deaminase OS=Plasmodium berghei (strain Anka) OX=5823 GN=ADA PE=1 SV=1
16	A5KE01	5.70e-25	106	363	0.259	0.259	ADA_PLAVS Adenosine deaminase OS=Plasmodium vivax (strain Salvador I) OX=126793 GN=ADA PE=1 SV=1
17	K6UCV4	9.47e-25	105	363	0.259	0.259	ADA_PLACD Adenosine deaminase OS=Plasmodium cynomolgi (strain B) OX=1120755 GN=ADA PE=1 SV=1
18	Q8IJA9	4.92e-24	103	367	0.251	0.248	ADA_PLAF7 Adenosine deaminase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=ADA PE=1 SV=1
19	Q8X1T6	3.40e-23	101	364	0.231	0.231	ADE_EMENI Adenine deaminase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aah1 PE=1 SV=1
20	Q72V44	4.79e-22	99.0	442	0.229	0.188	CADD_LEPIC Cyclic adenylate deaminase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) OX=267671 GN=add PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00962 A_deaminase	4.7e-129	441.8	Adenosine deaminase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361965

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000353731	0.997	Dipeptidyl peptidase 4
2	9606.ENSP00000286621	0.992	Adenosine kinase
3	9606.ENSP00000354532	0.990	Purine nucleoside phosphorylase
4	9606.ENSP00000257770	0.973	5'-nucleotidase
5	9606.ENSP00000286648	0.954	Deoxycytidine kinase
6	9606.ENSP00000382731	0.940	Adenosine deaminase 2
7	9606.ENSP00000339479	0.935	Cytosolic purine 5'-nucleotidase
8	9606.ENSP00000235628	0.925	Cytosolic 5'-nucleotidase 1A
9	9606.ENSP00000389948	0.923	7-methylguanosine phosphate-specific 5'-nucleotidase
10	9606.ENSP00000357459	0.920	Double-stranded RNA-specific adenosine deaminase
11	9606.ENSP00000484415	0.920	Cytosolic 5'-nucleotidase 3A
12	9606.ENSP00000245552	0.916	5'(3')-deoxyribonucleotidase, cytosolic type
13	9606.ENSP00000356205	0.915	Adenosine receptor A1
14	9606.ENSP00000373674	0.914	5'(3')-deoxyribonucleotidase, mitochondrial
15	9606.ENSP00000352904	0.913	Cytosolic 5'-nucleotidase 1B
16	9606.ENSP00000358730	0.909	Transmembrane domain-containing protein TMIGD3
17	9606.ENSP00000433415	0.900	NT5C1B-RDH14 readthrough
18	9606.ENSP00000304501	0.898	Adenosine receptor A2b
19	9606.ENSP00000336630	0.898	Adenosine A2a receptor
20	9606.ENSP00000419851	0.894	GMP synthase [glutamine-hydrolyzing]

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004000	1.000	adenosine deaminase activity
GO:0046872	0.997	metal ion binding
GO:0005515	0.996	protein binding
GO:0008270	0.994	zinc ion binding
GO:0097159	0.335	organic cyclic compound binding
GO:1901363	0.326	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009119	0.989	ribonucleoside metabolic process
GO:0009164	0.989	nucleoside catabolic process
GO:0065007	0.976	biological regulation
GO:0046128	0.969	purine ribonucleoside metabolic process
GO:0042454	0.969	ribonucleoside catabolic process
GO:0050789	0.968	regulation of biological process
GO:0050794	0.957	regulation of cellular process
GO:0072523	0.953	purine-containing compound catabolic process
GO:0050896	0.947	response to stimulus
GO:0048519	0.797	negative regulation of biological process
GO:0032501	0.712	multicellular organismal process
GO:0048523	0.563	negative regulation of cellular process
GO:0042221	0.442	response to chemical
GO:0002376	0.413	immune system process
GO:0048583	0.383	regulation of response to stimulus
GO:0009058	0.382	biosynthetic process
GO:0006796	0.377	phosphate-containing compound metabolic process
GO:1901576	0.370	organic substance biosynthetic process
GO:0044249	0.359	cellular biosynthetic process
GO:0044271	0.350	cellular nitrogen compound biosynthetic process
GO:0051716	0.342	cellular response to stimulus
GO:0048518	0.324	positive regulation of biological process
GO:0042110	0.320	T cell activation
GO:0034654	0.310	nucleobase-containing compound biosynthetic process
GO:0009117	0.307	nucleotide metabolic process
GO:1901566	0.306	organonitrogen compound biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0005886	0.970	plasma membrane
GO:0043227	0.917	membrane-bounded organelle
GO:0043229	0.901	intracellular organelle
GO:0043231	0.851	intracellular membrane-bounded organelle
GO:0031981	0.525	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:24408	1.000	adenosine + H(+) + H2O = inosine + NH4(+)
EC:3.5.4.4	1.000	adenosine deaminase.

[back to server]